SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XYR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XYR4
Domain Number 1 Region: 146-272
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-35
Family Phosphotyrosine-binding domain (PTB) 0.00019
Further Details:      
 
Domain Number 2 Region: 6-110
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000113
Family Phosphotyrosine-binding domain (PTB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XYR4
Sequence length 407
Comment (tr|M3XYR4|M3XYR4_MUSPF) Docking protein 2 {ECO:0000313|Ensembl:ENSMPUP00000004215} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DOK2 OC=Mustelinae; Mustela.
Sequence
MEEVAVKQGFLYLLQQQTFGKKWRRFGAVLYGESDCALARLELQEGPEKPRRGEAARRVI
RLSDCLRVAEASGEASSPRDTSAFFLETKERQYQLAAPASERSDWIQAICLLAFPGQRKE
LLGPTGKGSRPRMEENELYSSTTAVAPRKEFVVTMRPTEASERCRLRGSYTLRAGETALE
LWGGHELGSKLYEWPYRFLRRFGRDKVTFSFEAGRRCISGEGNFEFETRQGNEIFSALEE
AISAQKNSTHPGPPSQPATVPAVLPRPESPYSRPHDSLPPPSPSTPVPSARPRGPEGEYA
VPFDAVARNLGKSLRGVLAVPPHVPADPLYDSIEEHLPPRPDHIYDEPEGVAALSLYDSP
QEPQGEAWRRQATADRDRGLQRGQDLSAAGWPQGTEYDNVILKKGPK
Download sequence
Identical sequences M3XYR4
ENSMPUP00000004215 XP_004763382.1.14098 ENSMPUP00000004215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]