SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XYX7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XYX7
Domain Number 1 Region: 13-137
Classification Level Classification E-value
Superfamily Bromodomain 6.15e-41
Family Bromodomain 0.0002
Further Details:      
 
Domain Number 2 Region: 261-380
Classification Level Classification E-value
Superfamily Bromodomain 7.59e-39
Family Bromodomain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XYX7
Sequence length 944
Comment (tr|M3XYX7|M3XYX7_MUSPF) Bromodomain testis associated {ECO:0000313|Ensembl:ENSMPUP00000004278} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=BRDT OC=Mustelinae; Mustela.
Sequence
MSLSSRQTALVNPPPPEYINTKKNGRLTNQLQYLQKVVLKALWKHSFSWPFQQPVDAVKL
KLPDYYTIIKTPMDLNTIKKRLEHKYYVKASECIADFNIMFSNCYLYNKPGDDIVLMAQA
LEKLFRQKLSQMPQEEQVVGGKERIKKGIQHNVTVPSVKEKQSPTALEQVFKPQVIPSVF
PETSVSPSNMAQGTPFNSTSQTVAQVTRGVKRKADTTTPTASVVKASGESSPTLAEKKSL
KMPPIKENVLKTVLPDSQQQCKVVKNVKVTEQLRHCSEILKEMLAKKHLSYAWPFYNPVD
VNALGLHNYYDIVKNPMDLGTIKGKMDNQEYKDAYEFAADVRLMFMNCYRYNPPDHEVVT
MARMLQDVFEMHFAKIPDEPVGSMPVCYIRTDTTKILGRESSSEASSEGNSSGDSEDERV
QRLAKLQEQLKAVHQQLQVLSQVPFRKLKKRNKSKREKKKEKANNRDENPRKKFNQVKLK
EKSKSNQPKKRKQQVFALKPEDEDNAKPMNYDEKRQLSLDINKLPGDKLGRVVHIIQSRE
PSLRNSNPDEIEIDFETLKASTLRELEKYVAACLRRKRLIKPQGKKITKSKEEFHSQKKQ
ELEKRLLDVNNQLNSRKCQAKPEKTQSSKAVGSGSRLSESSSSSTSSSSETESSSSDSSS
SGSSSDSESEMFPKFTGVKQNDSPKEQVKLRILKCMLGLTGIVQIPSSAQDQASAKTTLV
CQTSYSCETLPNHHQLAFNHQEVENVQSVKNISPLQNLPPSGDSEQHLNGLTVMHQCGDN
DTAMLESECQVSVQKDIKIKNADSWKSLGKPVKTSGVLKSSDELFNQFRKAAIEKEVKAR
TQELIRKHLEQNTKETKIFQENQRDLGFTQESFSNKTQNQYLGEEQKEHQQSSEAQDKYK
LWLLKDRNLAREKEQERRRREAMAGTIDMTLQSDIMTMFENNFD
Download sequence
Identical sequences M3XYX7
ENSMPUP00000004278 ENSMPUP00000004278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]