SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XZ27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XZ27
Domain Number 1 Region: 46-89
Classification Level Classification E-value
Superfamily WW domain 0.00000000101
Family WW domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XZ27
Sequence length 1504
Comment (tr|M3XZ27|M3XZ27_MUSPF) Centrosomal protein 164 {ECO:0000313|Ensembl:ENSMPUP00000004328} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CEP164 OC=Mustelinae; Mustela.
Sequence
MAGRPIRIGDQLVLEEDYDETYIPSEQEILEFAREIGIDPVKEPELMWLAREGIVAPLPV
EWKPCQDITGDIYYFNFANGQSTWDHPCDEHYRNLVIQERGKLSAPGAIKKKDKKKKKEK
KDKKDKENPKSLLALGSSLAPVHVPPGGLAPLRGLVDAPTSALRGSQNVSLGSSAESGQL
GELTLPSQGLKTSAYTKGLLGSIHEDKNALSLLALGEETNAEDEVESDNQSVRSSSELLK
NLHLDIGALGGDFEYEESPRTSQPEERKDASLYSDAAGPPTPGKLLSQGADGSLSGADGR
EQQGRGASARLPAKETDEKSDPGKSRIEVDPGGGQPAQATEKEAPEDSLDAGEEGSRRGE
AQVVEEKEPKEETLVPKESRSDRSQDSDISEHVKELQLSDSAASDPKSFPGLDFGFRGRI
SEHLLDVNVLSPVLDGAHWEAQRLGREDKDGSQSSQDEQRSKPSRGSERTYSAALAGLTR
LSPPLVPGRWHQSPLHSQATEEGPLQASEGQLKQEQAEESGDSAGSPVPPGSLKREETPS
PPAAHERGKEQRSWATELGLGQEEAKEPEEKVAASPAPPVFSEAERRACHAVLGHMGKEQ
GMPGGRRGEKGDHGPEPLLGFPWEGMGESGRSVEPAGPPKQASLKAMEEAVTQELERDRR
QLLESKQEKMQQLREKLWQEEEEEMLQLQQQKEKSLSSLKEQLRKATEEEETQMREEESR
RLSQLRAQVQSSTEADEGRIRAEQEASLQRLREELESLQKAERASLERQSRQMLEQLKEE
LEASEKREQAALNAEKEAALQQLRERLEQERKDAAAALEREHRAELERLSSSLEAKHREV
VSSLQRKMEEAQQKEAAQVQESLGWAEQRAHHVLEYEQELSGLLREKRQEVEREHERKMD
KMKEEHQQVVAEAREEYEAEERKQRAELLGHLTGELERLRRSHERELEAVRQVQDRQLED
LRRQHREQERKLQDLEVELETRTKDVKAKLAHLGLQEETARKEQQQLLHAQRQAALESEE
VTASYQHLEEAKKEHTHLLESNRQLRRLLDELRARRAELESQVEALESQVEALQTQSQRL
QKHISDLEAEAQRKQDMLKELEAKESSAAPCFEPDLHIEDLRKSLGTSKEETDLSLDSVR
HYLSAEGMALRSAKEFLVRQTRSMRRRQSALKAAQQHWRRELARAPEATKDPPGTKALED
ARQDLEEETRHLDEMKSAMRKGHDLLKKKEEKLNQLESSLREEALDEDTRRQTPKKGVTF
DLSDTDDVSSAGSESCPLPHYEWQCRQGEDHVNLTASATLPYKYHYLSSSLQRISSQLNG
VLSMLGSLNPQPPPPLFTSTPVPAPPRNPRSNPIPACSSLARVSAWPPLEPTTTQWAWDP
GLGPTLSSSVAQSVDDFLLEKWHKYFPTGVPFLSSSPAPMENRLGYVSASEQLRLLQRAH
SHGSGLEVGSTDFQSMIEANRKWLEHYRNDPKLHLFSSVPKPAATSGLLHLGLDENNRLR
VCHY
Download sequence
Identical sequences M3XZ27
ENSMPUP00000004328 ENSMPUP00000004328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]