SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XZ60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XZ60
Domain Number 1 Region: 19-135
Classification Level Classification E-value
Superfamily PH domain-like 7.6e-41
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000144
Further Details:      
 
Domain Number 2 Region: 777-815
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.00000000000471
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3XZ60
Sequence length 817
Comment (tr|M3XZ60|M3XZ60_MUSPF) ENAH, actin regulator {ECO:0000313|Ensembl:ENSMPUP00000004361} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ENAH OC=Mustelinae; Mustela.
Sequence
MGNLAYFKYLKFASFIFHSEQSICQARAAVMVYDDANKKWVPAGGSTGFSRVHIYHHTGN
NTFRVVGRKIQDHQVVINCAIPKGLKYNQATQTFHQWRDARQVYGLNFGSKEDANVFASA
MMHALEVLNSQETAQSKVAATQDSTNLRCIFCVFYLGPTLPRQNSQLPAQVQNGPSQEEL
EIQRRQLQEQQRQKELERERVERAERERLEQEQLEREQRERERQDRLERERLERIDRERE
QRERQERQEQRERQEQREREREQRERQEQLEREQLEWERERRLSAAAPSSDSSLYNAPLP
EYASCQPPSAPPPSYAKVISAPVSEATPDYAVVTALPPTSTPPTPPLRHSATRFAASVGS
AFHPVLPHYATVPRPLNKNSRPSSPVNTPSSQPSAAKPCAWSTSTVSPLPPSPPVMISSP
PGKATGPRPVLPVCVSSPVPPMPPSPTAPNGPLDSVPCPVSPPPTSGPAAPPPPPPLPSL
APRSHCGSQASPPPSTPLASTPSSKPSVLPSPSAAAPASAETPLNSVLGDSSASEPGLQA
ASQPAETPAQQGLVLGPPAPPPPPPLPPGPVPAPAALHPHPGPPPPPPLPAAGPPPPPPP
PPLPNQAPPPPPPPPAPPLPASGFFAGSASEDNRPLTGLAAAIAGAKLRKVSRMEDGSFP
SGGTTVGVNAASLKSDTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDK
NEESEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRPKSAPSSQPSANGVQTEGLD
YDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNSA
Download sequence
Identical sequences M3XZ60
ENSMPUP00000004361 ENSMPUP00000004361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]