SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3XZP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3XZP7
Domain Number 1 Region: 261-439
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000202
Further Details:      
 
Domain Number 2 Region: 1-161
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.02e-32
Family BAR domain 0.013
Further Details:      
 
Domain Number 3 Region: 135-236
Classification Level Classification E-value
Superfamily PH domain-like 1.49e-16
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3XZP7
Sequence length 621
Comment (tr|M3XZP7|M3XZP7_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000004548} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
ERKKKFEKDGERFYSLLDRHLHLSSKKKESQLQEADLQVDKERQNFFESSLDYVYQIQEV
QESKKFNIVEPVLAFLHSLFISNNLTVALTQDFLPYKQQLQLSLQNTRNHFSSTREEMEE
LKKRMKEAPQTCKLPGQPTIEGYLYTQEKWALGISWVKYYCQYEKETKMLTMTPMEQKPG
AKQGPLDLTLKYCVRRKTESIDKRFCFDIETNERPGTITLQALSEANRRLWMEAMDGKEP
IYHSPITKQEEMELNEVGFKFVRKCINVIETKGIKTEGLYRTVGSNIQVQKLLNAFFDPK
CPGDVDFHSSDWDIKTITSSLKFYLRNLSEPVMTYRLHKELVSAAKSDNLDYRLGAIHSL
VYKLPEKNREMLELLIRHLVNVCEHSKENLMTPSNMGVIFGPTLMRAQEDTVAAMMNIKF
QNIVVEILIEHFIKIYSGPPEESCTPPVPPPRVTARRHKPITISKRLLRERAIFYTSSLD
EREDEIQHQTPNGIITSSIESPRLPQYPKLPIQRSGESDTGRKSPSNWSVSDGKLESCPE
VDVGKLVSRLQDGGTKSIPKATNGPVPGTGPTKVPSFHIKRPAPRPLAHHKEGKCLRIPL
ESELKPAILHLKIFLRLEIIK
Download sequence
Identical sequences M3XZP7
ENSMPUP00000004548 ENSMPUP00000004548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]