SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y014 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y014
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily DEATH domain 8.48e-32
Family DEATH domain, DD 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y014
Sequence length 216
Comment (tr|M3Y014|M3Y014_MUSPF) Protein FADD {ECO:0000256|PIRNR:PIRNR018586} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FADD OC=Mustelinae; Mustela.
Sequence
MDPFLVLLHSVSTGLSDDELTELKFLCRARVGKRKLESVRCGLDLFAVLLEQNELDAERP
ELLRELLASLRRHDLLRRLDAFEAGAAGRAPPEEPDLRAAFDIVCDNVGRDWRRLARHLH
VTDTKIDAIEEKYPRNLTEQVRESLRVWKSAEREDATVSHLVRALRACQLNLVADLVLED
QQARENETAGSGGGDKSPAESLTSWDSNGPALGGPW
Download sequence
Identical sequences M3Y014
XP_012915473.1.14098 ENSMPUP00000004665 ENSMPUP00000004665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]