SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y096 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y096
Domain Number 1 Region: 87-233
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-27
Family Phosphotyrosine-binding domain (PTB) 0.009
Further Details:      
 
Weak hits

Sequence:  M3Y096
Domain Number - Region: 498-531
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.00194
Family Ypt/Rab-GAP domain of gyp1p 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y096
Sequence length 560
Comment (tr|M3Y096|M3Y096_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000004747} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEHADDTSTKEDEKPELKIISNGDEQLEKAMEEILRDSEKGQSSLPVDCQSSTEISEHSF
GDISASQTNKPSLQLILDPSNTEISTPRPSSPSGLPEEDSVLFNKLTYLGCMKVSSPRNE
VEALRAMATMKSSSQHPFPVTLYVPNVPEGSVRIIDQSNNVELASFPIYKVLFCARGHDG
TTESNCFAFTESSHGSEEFQIHVFSCEIKEAVSRILYSFCTAFKRSSRQVTDVKDSIIPT
PDSDVFTFSVSLEVKEDDGKGNFSPVPKDRDKFYFKLKQGIEKKVVITVQQLSNKELAIE
RCFGMLLSPGRNVKNSDMHLLDMESMGKSYDGRAYVITGMWNPNIPIFLALNEETPKDKR
VYMTVAVDMVVTEVVEPVRFLLETVVRVYPANERFWYFSRKTFTETFFMRLKQSEGKGHT
SAGDAIYEVVSLQRQSEKEEPVTPTSGGGPMSPQEDEADEESDNELSSGTGDVSKDCPEK
ILYSWGELLGRWHSNLGARPKGLSTLVKSGVPEALRAEVWQLLAGCHDNQAMLDRYRLLI
TKHPGDCIAVNRTSEASSPA
Download sequence
Identical sequences M3Y096
ENSMPUP00000004747 ENSMPUP00000004747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]