SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y0D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0D4
Domain Number 1 Region: 1534-1643
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-24
Family Pleckstrin-homology domain (PH domain) 0.0035
Further Details:      
 
Domain Number 2 Region: 167-264
Classification Level Classification E-value
Superfamily SMAD/FHA domain 2.21e-20
Family FHA domain 0.0014
Further Details:      
 
Weak hits

Sequence:  M3Y0D4
Domain Number - Region: 889-991,1535-1555
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0178
Family BAR domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y0D4
Sequence length 1654
Comment (tr|M3Y0D4|M3Y0D4_MUSPF) Pleckstrin homology like domain family B member 1 {ECO:0000313|Ensembl:ENSMPUP00000004785} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PHLDB1 OC=Mustelinae; Mustela.
Sequence
MWRVISPIYSSSWQGLERAPREKQQCPPEPEAAAAEQGEGTRVPLSPREAPRWPAGRTLV
ESRPPAPHSSHSPADRRQRALHRARGPSWASSPPAPARPPLWTRNVCGVQPGGGGNPGDK
SWEPWSPRTMDALNRNQGGPGCKTQAMVKKGPLDLIETGKGLKVQTDKPHLVSLGSGRLS
TAITLLPLEEGKTVIGSAARDISLQGPGLAPEHCYIENVRGTLTLHPCGNVCSIDGLPVR
QPTRLTQGCMLCLGQSTFLRFNHPAEAKWMKSMIPAGGRAPGPPYSPGSESESLVNGNHA
AQPATRGPSACASHSSLVSSIEKDLQEIMDSLVLEEPGAAGKKPAATSPLSPMANGGRYL
LSPPTSPGAMSVGSSYENTSPAFSPLSSPASSGSCASHSPSGQEPAPSMPPLVPARSSSY
HLALQPPQSRPSGARASESPRLGRKGGHERPPSPGLRGLLTDSPAATVLAEARRATESPR
LGGQLPVVAISLSEYPASGARSQPTSIPGSPKFQPPVPAPRNKIGTLQDRPPSPFRELPG
TERVLTTSPSRQLVGRTFSDGSATRTLQPPESPRLGRRGLDSMRELPPLSPSLSRRVLSP
MPTRTAPDPKLPREVADSPRPRRWAAHGASPEDFSLTLGARGRRTRSPSPTLGESLAPRK
GSFSGRLSPAYSLGSLTGASPRQSPRAQRKLSSGDLRVPVTRERKNSITEISDNEDDLLE
YHRHQRQERLWEQEMERLERQRLETILNLCAEYSRADGGPEAGELPSIGEATAALALAGR
RTSRGLSGATGSNTEEPGGATQRLWECVERSDEENLKEECSSTESTQQEHEDAPGTKLQG
EVLALEEERAQVLGRVEQLKVRVKELEQQLQESAREAEMERALLQGEREAERALLQKEQK
AMDQLQEKLVTLETGIQKERDKERAELAAGRRHLEARQALYAELQTQVDNCPESVREQLQ
EQLRREAEALETETKLFEDLEFQQLERESRVEEERELAGQGLLRSQAELLRSITKRKERL
AVLDNQAGQIRAQAVQESERLAREKNASLQLLQKEKERLTVLEGRYHSLTGGRPFPKTMS
TLKEAELLISKAPEMGPGPATLVPFPGSSEPAASSVPLTPPASIQLCPRAQEYVTLEQLK
AMWGSSPVPTAPAPGLPFWASASRDLVPATCLPPVLPSSSSAPLTPSPKMEELLPPAVDL
EQWYQELMAGLGTGPAAASPRSSPPPLPAKASRQLQVYRSKMDGEATSPLPRTRSGPLPS
SSGSSSSSSQLSVATLGRSPSPKSALLAQNGTGSLPRNLAATLQDIETKRQLALQQKGQQ
VIEEQRRRLAELKQKAAAEAQCQWDALHGAAPFPPGPSGFPPLMHHSILHHLPAGRERGE
DGEHAYDTLSLESSDSMETSISTGGNSACSPDNMSSASGLDVAKIEEMEKMLKEAHAEKS
RLMESREREMELRRQALEEERRRREQVERRLQSESARRQQLVEKEVKMREKQFSQARPLT
RYLPIRKEDFDLKTHIESSGHGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFVFDRL
KRTLSYYVDKHETKLKGVIYFQAIEEVYYDHLRSAAKKRFFSFSVVTESPNPALTFCVKT
HDRLYYMVAPSAEAMRIWMDVIVTGAEGYTQFMN
Download sequence
Identical sequences M3Y0D4
ENSMPUP00000004785 ENSMPUP00000004785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]