SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y0K1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0K1
Domain Number 1 Region: 23-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.32e-70
Family FCH domain 0.0055
Further Details:      
 
Domain Number 2 Region: 437-497
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-18
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y0K1
Sequence length 499
Comment (tr|M3Y0K1|M3Y0K1_MUSPF) Protein kinase C and casein kinase substrate in neurons 3 {ECO:0000313|Ensembl:ENSMPUP00000004852} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PACSIN3 OC=Mustelinae; Mustela.
Sequence
NAMAPEEDAGGEALEGSFWEAGNYRRTVQRVEDGHRLCGDLVSCFQERARIEKVYAQQLA
DWARKWRGTVEKGPQYGTLEKAWHAFFTAAERLSALHLEVREKLQGQDSERVRAWQRGAF
HRPVLGGFRESRAAEDGFRKAQKPWLKRLKEVEASKKSYHAARKEEKTAQTRESHAKADS
AVSQEQLRKLQERVERCAREAEKMKSHYEQTLAELHRYTPRYMEDMEQAFESCQAAERQR
LLFFKDMLLTLHQHLDLSSSERFHELHRDLHQGIEAVSDEEDLHWWRSTHGPGMAMNWPQ
FEEWSLDTQRTISRKEKGGRSPDEVTLTSIVPTRDGAAPPPQSPGSPGLHLNWVANWCQE
PQALCSCPPWVAGSVPGSRVQMAEVRPGSLSSFPPAFPRVLPEGDPLSWVVDSLTNSPLC
SGGQDEEWSDEENTRKAATGVRVRALYDYAGQEADELSFRAGEELLKMSEEDEQGWCQGQ
LQSGRIGLYPANYVECVGA
Download sequence
Identical sequences M3Y0K1
ENSMPUP00000004852 ENSMPUP00000004852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]