SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y0K5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0K5
Domain Number 1 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.86e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 261-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.06e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 3 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.29e-21
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-19
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 5 Region: 177-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.39e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-18
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 430-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-17
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 318-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-17
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000183
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 83-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000883
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 224-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000177
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y0K5
Sequence length 642
Comment (tr|M3Y0K5|M3Y0K5_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000004856} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MDSVAFEDVTVHFSLEEWALLNPSQKKLYRDVMQETLRNLALVGEKWEDRNGKSLYEHHQ
TNLSKPVVESPCKNKEGSPCEESFSQNPNHKQINKTPAGIKLRKCSFCGQVFRHHSSFSR
HMISHTGHKLYEYQEYEEKPYKCKECGKAFKHRQSIRVHVRTHTGEKPYKCKHCGKAFKH
CQSIRKHERIHTGEKPYECKQCGEAFRYRHNFQKHERTHTGEQPYRCKHCGKALSCLSYC
RIHERTHTGEKPYECKQCGKAFSYASYIRIHERTHTGEKPYECKKCGKAFSCPNYFRKHE
KTHTGEKPYECKQCGKGFSCPRSFRSHEKRHRGEKPYECKICGKTYSCPIYFRNHERRHS
GEKSYQCKICGKAFSCPKYFRKHERSHTGEEPCECKDCENSLTPLPVFQTHVVKHSGDGP
YKCKECGKVFDCPTNFRCHEKIHSGEKPHECKECGKAFGSSMSLQNHERSHSRKKPHACK
ECGKAFSFPCSLQKHERSHTGEKPYACKQCGKAFTYLSSVQKHERTHSGEKPYACKQCGK
AFIYLSSMQKHERTHSGEKPYECEQCGKAFITLSNVQRHMIKHTGDGPCKCKECGKAFDC
PSSLRTHERTHTGEKPYQCKHCSKAFTRSSSLRNHERTHNGE
Download sequence
Identical sequences M3Y0K5
ENSMPUP00000004856 ENSMPUP00000004856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]