SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y0S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0S4
Domain Number 1 Region: 279-397
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-46
Family MBT repeat 0.0000393
Further Details:      
 
Domain Number 2 Region: 166-279
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 9.78e-41
Family MBT repeat 0.00000602
Further Details:      
 
Domain Number 3 Region: 383-505
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.25e-36
Family MBT repeat 0.0000511
Further Details:      
 
Domain Number 4 Region: 640-713
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.29e-16
Family SAM (sterile alpha motif) domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y0S4
Sequence length 728
Comment (tr|M3Y0S4|M3Y0S4_MUSPF) L3MBTL4, histone methyl-lysine binding protein {ECO:0000313|Ensembl:ENSMPUP00000004925} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=L3MBTL4 OC=Mustelinae; Mustela.
Sequence
MGTRIQICVVSEPAGKQLWGVPVLILSLGDSPRPETLSGPATTNHCLPSWFLLLFLCYSL
YDKSPLTKNTFALALVDSQTIKTLLRSAQVAMKQPNRKRKLSMDSKEHLNQDGCLEQAEE
DKKPRDGATPLSHVPSVAAQEAWSWEQYLTEQKAIAAPVELFSKDQSFPEHENGFQVGMR
LEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKHEL
HIPKGYRKDKFVWMDYLKACKLQNAPKKLFRNRSSNGPMPKEFQVGMKLEAVDRKNPSLV
CVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPYVQPVGWCQENGRTLIAPQGYPDPENF
SWTEYLEATQTNAVPAKVFKMRTPHGFLPSMRLEAVDRRNPRLIRVATVIDVDDQRVKVH
FDGWDHKYDYWMDADSPDIHPIGWCDITGHPLEIPYRANDVKILPGQAVCPTPGCRGIGH
IRGPRYSGHHSAFGCPYSDMNLKKEATLHDRLREQTQANLEPDSSHSKPKNICGLNFNGK
HEMVNSQPRLVQQAKCLKIKGKEDIDLDNLFRGGDSGKSLTRQEEICVLVPTLQTKYSAE
QTQQVLHQSIFMSSVSAHPFRDLPLGREQHCKLLPGVANIQASEVARWTVDEVAEFVQSL
LGCEEHAKCFKKEQIDGKAFLLLTQTDIVKVMKIKLGPALKIYNSILMFRNSQDLTEEDS
LSGQEARG
Download sequence
Identical sequences M3Y0S4
ENSMPUP00000004925 ENSMPUP00000004925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]