SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y0S9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3Y0S9
Domain Number - Region: 110-134
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0822
Family Cyclophilin (peptidylprolyl isomerase) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y0S9
Sequence length 393
Comment (tr|M3Y0S9|M3Y0S9_MUSPF) Protein Wnt {ECO:0000256|RuleBase:RU003500} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=WNT2B OC=Mustelinae; Mustela.
Sequence
MVKPGSAEEAAQLPLRRTRAPVPALGPGPAAPDGSRASARLGLACMLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDIHTCKAPKKAEWLDQT
Download sequence
Identical sequences M3Y0S9
ENSMPUP00000004930 XP_004769847.1.14098 ENSMPUP00000004930

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]