SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y0W4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y0W4
Domain Number 1 Region: 12-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.49e-81
Family BAR domain 0.0000000178
Further Details:      
 
Domain Number 2 Region: 301-365
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y0W4
Sequence length 368
Comment (tr|M3Y0W4|M3Y0W4_MUSPF) SH3 domain containing GRB2 like 1, endophilin A2 {ECO:0000313|Ensembl:ENSMPUP00000004965} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SH3GL1 OC=Mustelinae; Mustela.
Sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDEDFKEMEKKVDVTSKAVTEVLARTIEYLQP
NPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGES
MKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGRIPD
EELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILDELADKL
KRRMRDASSRPKREYKPKPREPFDLGEPEQSNGGFPCATAPKITPSSSFRSSDKPIRTPS
RSMPPLDQPSCKALYDFEPENAGELGFHEGDVITLTNQIDENWYEGMLHGQSGFFPLSYV
EVLVPLPQ
Download sequence
Identical sequences M3Y0W4
XP_004771506.2.14098 ENSMPUP00000004965 ENSMPUP00000004965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]