SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y154 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y154
Domain Number 1 Region: 406-695
Classification Level Classification E-value
Superfamily Folate-binding domain 2.51e-83
Family Aminomethyltransferase folate-binding domain 0.0000296
Further Details:      
 
Domain Number 2 Region: 3-193,304-368
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.32e-46
Family FAD-linked reductases, N-terminal domain 0.00045
Further Details:      
 
Domain Number 3 Region: 193-303
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.61e-29
Family L-aminoacid/polyamine oxidase 0.0072
Further Details:      
 
Domain Number 4 Region: 697-783
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 2.62e-22
Family Aminomethyltransferase beta-barrel domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y154
Sequence length 794
Comment (tr|M3Y154|M3Y154_MUSPF) Dimethylglycine dehydrogenase {ECO:0000313|Ensembl:ENSMPUP00000005055} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DMGDH OC=Mustelinae; Mustela.
Sequence
MKDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLEEETGQVVGFHQP
GSIRIATTPVRVDEFKYQMTRTGWHATEQYIIGPEKIQEMFPLLNMNKVLAGLYNPGDGH
IDPYSLTMALAAGARKYGALLKYPAPVTSLKPRSDGTWDVETPQGSMRANRVVNAAGFWA
REVGKMVGLEHPLIPVQHQYVVTSTIPEVKALKRELPVLRDLEGSYYLRQERDGLLFGPY
ESQEKMKVQDAWVTNGVPPGFGKELFESDLDRIMEHVEAAMEMVPVLKKADIINIVNGPI
TYSPDILPMVGPHQGLRNYWVAIGFGYGIIHAGGVGKYLSDWILHGEPPFDLIELDPNRY
GKWTTTQYTEAKARESYGFNNIVGYPKEERFAGRPTHRVNGLYKTLESKCSMGFHAGWEQ
PHWFYRLGQDTQYRPSFRRTNWFEPVGFEYKQVMQKVGVIDLSPFGKFNIKGQDSVRLLD
HLFANVIPKVGFTNISHMLTPKGRVYAELTVSHQTPGEFLLITGSGSELHDLRWIEEEAV
NGGYDVEIKNITDELGVLGVAGPHARKVLQKLTAEDLSDDVFKFLQTKSLKVSNIPVTAI
RISYTGELGWELYHRREDSAALYDIIMNAGQEEGIDNFGTYAMNVLRLEKAFRAWGSEMN
CDTNPLEAGLEYFIKLNKPADFIGKQALKQIKAKGLKRRLVCLTLATDDVDPEGNESIWY
DGKVVGNTTSGSYSYSIQKSLAFAYVPVELSKVGQQVEVELLGKNYPASVIQEPLVLTEP
TRNRLQKKGGKDKI
Download sequence
Identical sequences M3Y154
ENSMPUP00000005055 ENSMPUP00000005055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]