SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y163 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y163
Domain Number 1 Region: 142-443
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.27e-111
Family Pancreatic carboxypeptidases 0.0000000075
Further Details:      
 
Domain Number 2 Region: 46-137
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.47e-27
Family Pancreatic carboxypeptidase, activation domain 0.00000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y163
Sequence length 448
Comment (tr|M3Y163|M3Y163_MUSPF) Carboxypeptidase A1 {ECO:0000313|Ensembl:ENSMPUP00000005064} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CPA1 OC=Mustelinae; Mustela.
Sequence
MARRHLTWESLKGPRTFSETQLMFPVGCSMRGLLVLSVLLGAVLGKEDFSGHQVLRLSTA
DAAQVEKVKELEDLEHLQLDFWRGPAQPGSPIDVRVPFRSIQAVKIFLEAHGIGYTTMIE
DVQALLDEEQEQMFAFQARARSSDTFNYATYHTLEEIYGFMDMLVAEHPQLVSKLQIGNS
YEGRPIYVLKFSTGGENRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDSTLTAILD
SMDILLEIVTNPDGFAFTHSKNRMWRKTRSLTAGSSCVGVDPNRNWDAGFGMAGASSNPC
SETYHGKFANSEVEVKSIVDFVKNHGNIKAFISIHSYSQLLLYPYGYKAEAAPDRDELDQ
LAKSAVTALASLYGTKFKYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLL
PASQIVPTAQETWLALRTIMEHTLQHPY
Download sequence
Identical sequences M3Y163
ENSMPUP00000005064 ENSMPUP00000005064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]