SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y1M8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y1M8
Domain Number 1 Region: 1008-1103
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-25
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 2 Region: 394-498
Classification Level Classification E-value
Superfamily PDZ domain-like 1.24e-23
Family PDZ domain 0.0000561
Further Details:      
 
Domain Number 3 Region: 835-936
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-23
Family PDZ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 698-810
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-22
Family PDZ domain 0.00047
Further Details:      
 
Domain Number 5 Region: 552-662
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-17
Family PDZ domain 0.00024
Further Details:      
 
Domain Number 6 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.000000000000223
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000127
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000171
Family PDZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y1M8
Sequence length 1466
Comment (tr|M3Y1M8|M3Y1M8_MUSPF) Membrane associated guanylate kinase, WW and PDZ domain containing 3 {ECO:0000313|Ensembl:ENSMPUP00000005229} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=MAGI3 OC=Mustelinae; Mustela.
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDLGAEIRGGAERGEFPYLGRLREEPGGGTCCVV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSIDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
EDEDKDAVNGSGTAESRERHSESSDWMKTVPSYNQTNSSMDFRNYMMRDENLEPLPKNWE
MAYTDTGMVYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQADTGSSKPDMEKSHFTRDPSQLKGILIRASLKKSTMGF
GFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDNEDPVVDIVAATPVINGQSLTKGETCMNTQDFKSGAVVLDQ
NGKPGPTLISDRLNGPSDLSEQRASLASSGGSQPELVTIPLIKGPKGFGFAIADSPTGQK
VKMILDSQWCQGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPPSP
TKTAKMKTDKKENSGSLEAINEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPP
NTKDLDVFLRKQESGFGFRVLGGEGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIP
VKGKSHKQVLDLMTTAARNGHVLLTVRRKVFCEKQPEEDSSPAFLLTQNGSPRPHRAEVP
ARPAPQEAYDVVLQRKENEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKIGD
HISAVNGQSIVELSHDSIVQLIKDAGVTVTLTVVAEEEHHGPPSGTNSARQSPALQHRPM
GQSQANHVAGDRSALEGEIGKDVSTSYRHSWSDHKHLAQTDTAMISVVGTRPNQSLGCYP
VELERGPRGFGFSLRGGKEYNMGLFILRLAEEGPAIKDGRIHVGDQIVEINGEPTQGITH
TRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDVNTPSSSNVIYDEQPPFPPPFHSASVFE
EFPAPGIEESLMRVQIYEKTEELKDGVPEKKSTLNENLSDRKQHSFLQKNVNKGDPPSSH
GQSDKKNLFRVENGVTQRGRSASPRKPAGRHAEHSDRLPSPLLADPKRRPRDRSLSPRKG
DRKGGQMDTRAGSGQDHCGRSRGRSSSPKKPQKPEGNKGRVNTEARLSESESQRGGGRAR
DGAEQISEGREESGVVWKDTKHSQSGKNRTRSPEKKSKRMEEKSLPSKKTSTAAGRVLSD
REKGKKATLGETSSSKEKPGENARISDKKLKQDPEERMVLNKTREGGGFQPESASPVKKT
PITPGPWKVPSAHKAAGTTGVAEKRL
Download sequence
Identical sequences M3Y1M8
ENSMPUP00000005229 ENSMPUP00000005229 XP_004769884.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]