SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y214 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y214
Domain Number 1 Region: 908-937
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000485
Family A20-like zinc finger 0.018
Further Details:      
 
Weak hits

Sequence:  M3Y214
Domain Number - Region: 106-143
Classification Level Classification E-value
Superfamily UBA-like 0.000485
Family TAP-C domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y214
Sequence length 946
Comment (tr|M3Y214|M3Y214_MUSPF) OTU deubiquitinase 7B {ECO:0000313|Ensembl:ENSMPUP00000005365} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=OTUD7B OC=Mustelinae; Mustela.
Sequence
RGVEQAKNHWGRPVLISAVWLQLLILCGATAAVAVSATASASIVVGGGASRTPGSQPRNE
ERRPGPALRPGLGPCPGSREGGGLNFDLCPPYLSCLKVLNDHMTLDMDAVLSDFVRSTGA
EPGLARDLLEGKNWDMSAALSDFEQLRQVHAGNLPPPFSEGSGGSRTPEKGFSDRESARP
PRPTLQRQDDIVQEKRLSRGISHASSSIVSLARSHVSSNGGGGGSSEHPLEMPICAFQLP
DLTVYNEDFRSFIERDLIEQSMLVALEQAGRLNWWVSVDPTCQRLLPLATTGDGNCLLHA
ASLGMWGFHDRDLMLRKALYALMEKGAEKEALKRRWRWQQTQQNKEQEVVFTESSASKEL
HAKRILEGKRGAVARIQKGVRMSWVESSEEPVYESLEEFHVFVLAHVLRRPIVVVADTML
RDSGGEAFAPIPFGGIYLPLEVPVSQCHRSPLVLAYDQAHFSALVSMEQKENAKDQAVIP
LTDSEHKLLPLHFAVDPGRGWEWGKDDNDNVRLASVILSLEVKLHLLHGYMNVKWIPVSS
DAQAPLAQPESPTASAGDEPRSTPESGDSDKESVGSSSTSNEGSKRKEKSKRGREKDKKR
ADSVANKLGSFGKTLGSKLKKNMGGLMHSKGSKPGGVGTGSGVSSGTGTETLEKKKKNSL
KSWKGGKEEAVGDGAVSEKPTSESVGNGGSKYSQEVMQSLSIMRIAMQGEGKFIFVGTLK
MGHRHQYQEEMIQRYLADAEERFLAEQKQKEVERKILNGGLGSGPPPAKKPEPDGGEELL
PAPPAESKPVAFSAGYPGGFTIPRPAGAGVHCQEPRRQLAGGPCGGGLPPYATFPRQCPP
GRPYPHQDCIPSLEPGSHSKDGHRGALLPPPFRVADSYSNGYREPPEPDGWAGGPRGLPP
TQTKCKQPNCSFYGHPETNNFCSCCYREELRRREREPGGELLVHRF
Download sequence
Identical sequences M3Y214
ENSMPUP00000005365 ENSMPUP00000005365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]