SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y259 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y259
Domain Number 1 Region: 574-770
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-46
Family SPRY domain 0.011
Further Details:      
 
Domain Number 2 Region: 509-603
Classification Level Classification E-value
Superfamily Fibronectin type III 9.11e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 295-355
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.59e-16
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 2-39
Classification Level Classification E-value
Superfamily RING/U-box 0.000000012
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  M3Y259
Domain Number - Region: 207-241
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00377
Family TFIIH p44 subunit cysteine-rich domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y259
Sequence length 781
Comment (tr|M3Y259|M3Y259_MUSPF) Tripartite motif containing 67 {ECO:0000313|Ensembl:ENSMPUP00000005410} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRIM67 OC=Mustelinae; Mustela.
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLHSRGSGLPAG
AAAAPPLDHDAAAGPACGGASGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLK
SPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSSITCPQCHRSASLDHRGLRGFQRN
RLLEAIVQRYQQGRGAVHGASAAAAVAICQLCDRTPPEPAATLCEQCDVLYCAACQLKCH
PSRGPFAKHRLVQPPPPPAPAEAASATPGAAQGAPSGGGGCKSPGGAGAAGGSAARKFPT
CPEHEMENYSMYCVSCRTPVCYLCLEEGRHGKHEVKPLGAMWKQHKAQLSQALNGVSDKA
KEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLKM
VWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEPK
VSAEFDLTLDSEPLLQAIHQLDFIQMKCRVPPSPLLQLEKCCTHNNSVTLAWRMPPFTHS
PVDGYILELDDGDGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVVL
QTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYDN
HPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGVL
LDLNKHTLTFFINGQQQGPTAFSHVEGVFMPALSLNRNVQVTLHTGLEVPTNLGRPKLSG
N
Download sequence
Identical sequences M3Y259
XP_004776070.1.14098 ENSMPUP00000005410 ENSMPUP00000005410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]