SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y296 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y296
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-73
Family Protein kinases, catalytic subunit 0.00000636
Further Details:      
 
Domain Number 2 Region: 844-910
Classification Level Classification E-value
Superfamily G protein-binding domain 6.02e-22
Family RhoA-binding domain 0.0000524
Further Details:      
 
Domain Number 3 Region: 1014-1104,1186-1217
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000545
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 1123-1172
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000101
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  M3Y296
Domain Number - Region: 323-425
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000225
Family Myosin rod fragments 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y296
Sequence length 1252
Comment (tr|M3Y296|M3Y296_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000005447} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVN
LMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKM
NKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSL
VGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQW
AWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNR
RYLSSANPNDNRSSPNVDKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSKIKLDKI
MKELDEEGNQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQL
EDLKKVSQNSQLANEKLAQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSVSQLESLNR
ELQERNRILENSKTQTDKDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKH
NLERVEGERKEAQDMLNHSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQ
SIEEAKSVAMCEMEKKLKEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKE
RMEDEVKNLSLQLEQESNKRLLLQNELKTQAFEADNLKGQEKQMKQEINTLLEAKRLLEF
ELAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRESLKKIQELQS
EKETLATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEE
TTSMLTKDIEVLRKENEEITDKMRRAEEEYKLKKEEEISNLKAAFEKIINTERTLKTQAV
NKLAEIMNRKDFKIDRKKANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQ
AQLVEECAHKNELQMQLASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEG
WLSIPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGD
VYRAETEEIPKIFQILYANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCE
ACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQD
EQKKWVTHLVKKIPKNPPSGFVRASPRTLSTRSTANQSFRKAVKNTSGKTSS
Download sequence
Identical sequences M3Y296
ENSMPUP00000005447 ENSMPUP00000005447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]