SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y2Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y2Q7
Domain Number 1 Region: 527-746
Classification Level Classification E-value
Superfamily Bet v1-like 3.37e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 96-246
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y2Q7
Sequence length 755
Comment (tr|M3Y2Q7|M3Y2Q7_MUSPF) Collagen type IV alpha 3 binding protein {ECO:0000313|Ensembl:ENSMPUP00000005608} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=COL4A3BP OC=Mustelinae; Mustela.
Sequence
MQQNGNSIPPPFSAPPTIPLCVIRENRRLASKGLSSGGGAGRSAGVTTTATADGWKGRLP
SPLVLLPRSARCQARRRRRSGQTSSLLQLPPKPERAFFPSPSPGPLPRVLGASSGAAQGA
GAGLLIDCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKN
NTLSYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWI
DAIEQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRD
ILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNANGNKEKLFP
HVTPRGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKRRRIEE
AYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHW
PTSMPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSL
QDVGGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRN
DWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKIPALTENDPETWIVC
NFSVDHDSAPLNNRCVRAKINIAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWA
PASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences M3Y2Q7
ENSMPUP00000005608 ENSMPUP00000005608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]