SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y333 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y333
Domain Number 1 Region: 289-691
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.72e-134
Family Ankyrin repeat 0.000000000000462
Further Details:      
 
Domain Number 2 Region: 1-307
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.11e-93
Family Ankyrin repeat 0.000000728
Further Details:      
 
Domain Number 3 Region: 1290-1377
Classification Level Classification E-value
Superfamily DEATH domain 1.04e-23
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y333
Sequence length 1762
Comment (tr|M3Y333|M3Y333_MUSPF) Ankyrin 1 {ECO:0000313|Ensembl:ENSMPUP00000005734} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ANK1 OC=Mustelinae; Mustela.
Sequence
MAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPA
LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTP
QNGITPLHIASRRGNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGA
PIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVAKV
LLDKGAKPNSRALNGFTPLHIACKKNHIRVMDLLLKTGASIDAVTESGLTPLHVASFMGH
LPIVKNLLQREASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLYC
AARIGHVNMVKLLLENNANPNLATTAGHTPLHVAAREGHVETALALLEKEASQACMTKKG
FTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNHLDIVRLLLPRGGSPH
SPAWNGYTPLHIAAKQNQMEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLS
KQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKL
VKFLLQHQADVNAKTKQGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKR
LGYISVTDVLKVVTDEPSFVLTSDKHRLSFPETVDEILDVSEDEGTAHITIMGEELISKA
ERQDSRDIDEEKELLDFVPKLDQAVESPAIPKIPCVTPETVVIRAEEPEQASKEYDEDSL
IPSSPATETSDNISPVASPVHTGFLVSFMVDARGGSMRGSRHNGLRVVIPPRTCAAPTRI
TCRLVKPQKLSTPPPLAEEEGLASRIIALGPTGAQFLSPVIVEIPHFASHGRGDRELVVL
RSENGSVWKEHRSRYGESYLDMDQILNGMDEELGSLEELEKKRVCRIITTDFPLYFVIMS
RLCQDYDTIGPEGGFLKSKLVPLVQATFPENAVTKRVKLALQAQPVPDELVTKLLGNQAT
FSPIVTVEPRRRKFYRPIGLRIPLPPSWTDNPRDSGEGDTTSLRLLCSVTGGTDQAQWED
ITGTTKLVYANECAAFTTNVSARFWLSDCPRTAEAVNFATLLYKELTAVPYMAKFVIFAK
MNDPREGRLRCYCMTDDKVDKTLEQHENFVEVARSRDIEVLEGMPLFAELFGNLVPVRKA
AQQRSFQFQSFRENRLAIPVKVRDSSREPAGSLSFLRKAMKYEDAQHILCHLNITMPPCT
KVSSADERRRTLTPLALRYSILSEPSLGSLSGTDRANMKMAIISEHLGLSWAELARELQF
SVEDINRIRVENPNSLLEQSVALLNLWVIREGKNANMENLYTALRNIDRSEIVNMLEGSG
RQGRNLKPERRHGDRDYSSSPSQMNGYSSLQDELLSPASLHYALPSPLRADQYWNEVAVI
DAIPLAATEHDAMLEMSDMQVWSAGLTPSLVTAEDSSLECSKAEDSDATGHEWKPEGVLS
EGPQGSTLGSLDLVEDDTVDSDAINGLIDLLDQEEGQQRVQAHITESPSVSRVMEMSQDR
LQHWDEEGSIVSYLQDTARSSWPEEVTQGSHSFQSTITTIQELEPSGSHEYEKVLVSTAE
HVREGQPEAESRARRRQSHQEWVQEARSTFSLMAEGSEFQNIPGEQVTEEQFTDEQGNIV
TKKIIRKVVRQIDSSGVEASQEHEEVIAEGPLEDPREMEADVDSFMRHVQVELRGSSLQP
DLIESRKGAQIVKRASLKRGKQ
Download sequence
Identical sequences M3Y333
ENSMPUP00000005734 ENSMPUP00000005734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]