SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y360 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y360
Domain Number 1 Region: 126-200
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000302
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y360
Sequence length 391
Comment (tr|M3Y360|M3Y360_MUSPF) Spectrin repeat containing nuclear envelope family member 4 {ECO:0000313|Ensembl:ENSMPUP00000005761} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SYNE4 OC=Mustelinae; Mustela.
Sequence
MALPPPLGPRPPSEPLNHPPGAPREPDIGGFTLCPASEERLRPDQAQKLGQDSLDPPQHL
QGGLGGTEPAAGPLRLPAPTSSEDAAAAKHCEHLSSGQEVLEAEQDSLALCLLGLGLRLR
DLERGLGPWASAQSRMGQLQALQADLRGAAERIDALLAFGEGLAQRSEPQARASLEQVLR
ALRAHRSSIFRRLWWLQAQLVSSSLVFEEASPLDQDLEVEGDLDGPGPGGIWGPWTPSSY
PTPAELEWDPAGDVGGLRPLWQKTAWTPGAPCELCGHRGPQGRGQGLEDMLMSGFSHWKH
LAGQRRRSLLRKSQDKKRASPNLQGVMLEVDPGAPPPASGHSLILLLLLLFLLLVGATLL
LPPSGGSCCSSARLAGTPYLVLSYVNGPPPI
Download sequence
Identical sequences M3Y360
ENSMPUP00000005761 ENSMPUP00000005761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]