SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y3A2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y3A2
Domain Number 1 Region: 1116-1292
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.22e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 678-793
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.96e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0014
Further Details:      
 
Domain Number 3 Region: 444-565
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-25
Family Pleckstrin-homology domain (PH domain) 0.0000126
Further Details:      
 
Domain Number 4 Region: 913-1031
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-22
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 5 Region: 1426-1561
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-18
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 6 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.89e-16
Family SAM (sterile alpha motif) domain 0.0000577
Further Details:      
 
Domain Number 7 Region: 577-677
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000249
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 1008-1108
Classification Level Classification E-value
Superfamily PH domain-like 0.000000115
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y3A2
Sequence length 1700
Comment (tr|M3Y3A2|M3Y3A2_MUSPF) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSMPUP00000005803} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARAP2 OC=Mustelinae; Mustela.
Sequence
MSSVSEVNVDIRDFLMSINLEQYLPRFREFGLNTVKDCAAVNDGLLHKIGISPTGHRKRI
LKQLQIILSKMQDIPIYANIHKTKKDDETSEDRHSPSSGQNTSTELSDTGDMQVSGLTRW
ETVTKNLDRNDIANSQSLKSDDDLSHLKQNFPVPEEEPHQNLSSFQHTLLGNENIKAESL
ITEKTTDFAVEEQQTKRFEVISENASKLPDVDPECLSSLGCSISEAHSGNETNGLTERSP
PSPFFQFKGEMVVNDLYVPSSPILAPMRSRSKLVSRPSRSFLLRHRPVPEIPGSTKGISG
SYFRERRNVATSTDSNEENSSSIFPYGETFLIQRLENFKKRSIKNEFWTHEETLKGETTT
ERNSFVIKSSIYDNRKENISEDKVEDIWIPREDKNNLPVDSASESEYSTVEECFQSLRRK
NSKASKSRTQKALTMDPVNRHSYPLSSTSGNAESSIVSSNAISPYACFYGSSARKVKSGW
LDKLSPQGKRMFQKRWVKFDGLSISYYNNEKEKYSKGIIPLSAISTVRVQGDNKFEVVTT
QRTFVFRVEKEEERNDWISILLNALKSQSPALQSQAAATPEKCGYLELRGYKAKIFTVLS
GSSVWLCKNEQDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRSFSFTAESEKEKQ
EWIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHR
SLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKT
FITQKYKEGRFRKTLLASLTKEELNKALCAAVVKPDVLETMALLFSGADVMCATGDPVHS
TPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSEGGLGQESSQSTFLCDFLYQAPSAASK
LSSEKKLLEETNKKWCVLEGGFLSYYENDKSTAPNGTININEVICLAVHKEDFYLNTGPI
FTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHFVPFVAENLTEADYDLIGQLYYKDCHA
LDQWRKGWFSMEKSSLRFCLQMQEVQEDRMYLRRLQELTISTVVQNGEKIDVLLLVEKGR
TLYIHGHSKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKY
IYQKNGDPLHISELLESFKKDARSFKLRAGKHQLEDVTGVLKNFLSDIDDALLTKELYPY
WISALDTQDDKERIKKYGAFIRSLPGVNRATLAAVIEHLYRVQKCSEINHMNAHNLALVF
SSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDL
LIEVYVERKEPDCSIIIRISPVMEAEELTNDILAIKNIIPMKGDIWATFEVIENEELERP
LHYTENVLEQVLRWSSLSEPGSAYLVVKRFLTIDTIKHYNERRALESIKEGMLKIKEEPS
KILSGNKFQDRYFVLRDGYLFLYKDSKSSKYDKMFSLGSLKFYLGVKKKMKPPTSWGLTA
YSEKHHWHICCDSLQTQMEWMANVFIAQHENDIRPPAGKERKRSITKNPKIGGLPLIPIQ
HERSATQARRNIESARAELERLRVSEKRDQELGDSSLKERASMVAHCLEHKDEKLRTRTR
KHRSFNCLEDTEAEVFPGQQKSHKGLKTLRKTEDRNGKAALDSDSKLPSRVIEELSVVLQ
RTRTLPRDLEDEQILQKEIK
Download sequence
Identical sequences M3Y3A2
ENSMPUP00000005803 ENSMPUP00000005803 XP_012917659.1.14098 XP_012917660.1.14098 XP_012917661.1.14098 XP_012917662.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]