SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y3D6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y3D6
Domain Number 1 Region: 175-270
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000177
Family DEATH domain, DD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y3D6
Sequence length 278
Comment (tr|M3Y3D6|M3Y3D6_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000005837} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MLSTTACAVLCHQKDNPRRVVILVVPSKDLSQVLRGLRLEAFSGPPEPSRPFQVKEGDQL
LLRFTGNIFASSNGKDYEKDFKLIFHLQRKPRLELQIKEVDEFGNYSCPHYKGTIVIYKI
PKEKVVHNLDQSLILDENHHHLPICKLPLKLPKHKKLINRPQSTKIISTDPVGALWDNLL
HWLAEELSEENAARLSSSLPVRRSTVELIRLKSPGDLTEQIHELLCFWKKSLPKSTDKVR
LLARHLRQIGRRDLAEELKFKWEQKVFTEPQQWFDKTE
Download sequence
Identical sequences M3Y3D6
ENSMPUP00000005837 ENSMPUP00000005837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]