SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y484 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y484
Domain Number 1 Region: 381-450
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-16
Family SH2 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y484
Sequence length 468
Comment (tr|M3Y484|M3Y484_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000006135} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MAKWLNKYFSLGNSKTKSPPQPPRPDYRDQRRRGERPSQPPQAVPQASAGASASCGPAAA
SCFSTSSGSLPDDSGSTSDLIRAYRAQKERDFEDPYNGPGSSLRKLRAMCRLDYCGGGGE
PGGGQRAFSASSASGAAGCCCASSGAGAAASSSSSSGSPHLYRSSSERRPATPAEVRYIS
PKHRLIKVESAAGGAGDLPGGACSGGRTWSPTACGGKKLLNKCAASAAEESGAGKKDKVT
IADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSHHKGIQLYDTPY
EPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQ
SSPSPSRDRRRQLRAPGGGFKPIKHGSPEFCGILGERVDPAVPLEKQIWYHGAISRGDAE
NLLRLCKECSYLVRNSQTSKHDYSLSLKSKIPFMKKKDLKQHGGFRSS
Download sequence
Identical sequences M3Y484
ENSMPUP00000006135 ENSMPUP00000006135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]