SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y4J8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y4J8
Domain Number 1 Region: 154-354
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 41-150
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-30
Family Pleckstrin-homology domain (PH domain) 0.00000607
Further Details:      
 
Weak hits

Sequence:  M3Y4J8
Domain Number - Region: 547-640
Classification Level Classification E-value
Superfamily Tropomyosin 0.0386
Family Tropomyosin 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y4J8
Sequence length 646
Comment (tr|M3Y4J8|M3Y4J8_MUSPF) Rho GTPase activating protein 25 {ECO:0000313|Ensembl:ENSMPUP00000006249} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGAP25 OC=Mustelinae; Mustela.
Sequence
MSLKLPRNWDFNLKVEAGKIARSRSVMTGEQMAALHQLSAPNPLERPIKMGWLKKQRSIV
KNWQQRYFVLRAQQLFFYKDEEDTKPQGCMYLPGSTVKEIATNPEEVGKFVFEVIPASWD
QSRTGQDSYVLMASSQAEMEEWVKFLKRVAGTPSGAVFGQRLDETVAYEQKFGPHLVPIL
VEKCAEFILQHGLNEEGIFRLPGQDNLVKQLRDAFDAGERPSFDRETDVHTVASLLKLYL
RDLPEPVVPWNQYEGFLLCGQLMNADEAKAQQELVKQLSILPRDNYSLLSYICRFLHEIQ
LNCGVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDA
PLSPPAQKNDPKKPPVARSSVGWDATEDPPISRTESFSNVTSDSDTTSPTGQRPNDGFLE
ESSKAPREKLGDWKLQSRKRTQTLPNRKCFLTSAFQGANSSKVEIFKNEFWSPSSEVKAG
EGHRRTMSQGVPPCPDSQRTSTYDNVPAPPCTPGDEAAASSYQACDSKRETLASSTSETG
PGKKNSGEEELESLQRVVQELQKEIETQKQTYEEQIKNLEKENYDVWAKVVRLNEELEKE
KKKSAALEISLRNVERSREDVERRNKALEEEVKEFVKSMKEPKADA
Download sequence
Identical sequences M3Y4J8
XP_004742156.1.14098 ENSMPUP00000006249 ENSMPUP00000006249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]