SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y4N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M3Y4N1
Domain Number - Region: 16-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000817
Family GntR-like transcriptional regulators 0.062
Further Details:      
 
Domain Number - Region: 64-158
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0633
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y4N1
Sequence length 200
Comment (tr|M3Y4N1|M3Y4N1_MUSPF) Meiotic nuclear division protein 1 homolog {ECO:0000256|PIRNR:PIRNR026991} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSKKKGLSAEEKRRMMEIFFETKDVFQLKDMEKIAPKEKGITAMSVKEVLQSLVDDGMVD
CERIGTSNYYWAFPSKALLARKCKLEVLESQVSEGNQKHTNLQKSIEKAKIGLHETEESK
ELSSLRDQREQLKAEVEEYKECDPQVVEDIRQANKIAKEAANRWTDNIFSIKSWAKRKFG
FKENKIDKNFGIPEDFDYID
Download sequence
Identical sequences M3Y4N1
ENSMPUP00000006282 ENSMPUP00000006282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]