SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y4N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y4N2
Domain Number 1 Region: 14-82
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000276
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y4N2
Sequence length 813
Comment (tr|M3Y4N2|M3Y4N2_MUSPF) Cas scaffolding protein family member 4 {ECO:0000313|Ensembl:ENSMPUP00000006283} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CASS4 OC=Mustelinae; Mustela.
Sequence
MKGAGVMDGMPKTLLARALFDNHPDCSYELAFCRGDILTILEQNVPESEGWWKCLLHGRQ
GLAPANRLQILPEAPADRPCAPLLRGLEEPLTCSKDTYQVPTLLKPPTAGPVYEDMRSWV
EGPPRTATQVYEFPDPPAGARIVCEKTLSFPKQALFTMPRPARASLPTLPSQVYDVPAQS
RGPPALKEPEKRQLYDIPPSPQKAGLGPSASQLSGQCVPPTSAIAPRRGGYSTLPSPQKS
EWIYDWPVSPEKAEGTNASLSSFVEESEPHRPPGPMSSFQNPLNSRTWSHYPHLHKNVPM
QKKLSLPEIPSYQALAPRDTFPLDEDAGYKVPSSFLIPRVEQQNTKPNIYDIPKATPSDP
QAVNEPGRVGGAPEIAADGSSSWFSGRAPSLSPDSDRLSVSSSDSRASVVSSCSSTSTDS
SSGSCLEESGKELSLDPDLARETVVALQHEVASSVASLMLFVSRKWRFRDYLEANLSAIR
SAADRVEESLRAFLDFARGVRGTACNLSDTNLQARIRDQLQTISSSYQILLGTKESLDNC
KWSLEVLVTDKVQNSPDDLERFVMVARMVPEDIKRFASIVIANGRLLFKQNCEKEDTLQM
TPHGQLKPAKCIQLPQREMEPYEGSTPFNKQKENEHSPELLKKNGTIMCEPKSSNLEETE
TPISEGRSDENKNWEGQNPSSLILQPLSQQNPEKRFQLSEHCRLYFGALFKAISVFNHSL
SNSQPPEVFITQSKLVIMVGQKLVDTLCKETQERDVRNEILCGSSHLCSLLKNLALATKH
AVLKYPSPAALGHLQAEAQKLEQHTRQFRGTLE
Download sequence
Identical sequences M3Y4N2
XP_004759947.1.14098 ENSMPUP00000006283 ENSMPUP00000006283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]