SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y4R4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y4R4
Domain Number 1 Region: 323-400
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.62e-22
Family Intermediate filament protein, coiled coil region 0.00061
Further Details:      
 
Domain Number 2 Region: 94-127
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000023
Family Intermediate filament protein, coiled coil region 0.0029
Further Details:      
 
Weak hits

Sequence:  M3Y4R4
Domain Number - Region: 96-270
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y4R4
Sequence length 445
Comment (tr|M3Y4R4|M3Y4R4_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000006315} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
SPGLSSYSPNSMSFTTHSTFSSNYRSLGSMQSPSHRVRPVSSAASVYAGAGGSGSRISVS
RSTSFRGGWGSGGLATGLTAGMARGLAGIGGMQGEKETMQDLNDRLASYLERVRSLEADN
QRLEVRIREHLEKKGPQVRDWGHYFKTIEELRSQIFASSVDNARIVLQIDNARLAADDFR
VKYETELAMRQSVESDIHGLRKVIDDTNVTRLQLETEIEALKEELLFMKKNHEEEVKGLQ
NQIANSGLTVELDAPKSQDLSKIMADIRAQYDELARKNREELDKYWSQQIEESTTVITTQ
TSEIGEAEMTLTELRRTAQSLEINLDSMRNLKASLENSLREVETRYAMQMEQLNGVLLHL
ESELSQTRAEGQRQAQEYEALLNVKVKLEAEIATYRRLLEDGEDFNLSDALDSSSSMQTI
QKTTTRKIVDGKVVSETNDTKVLRR
Download sequence
Identical sequences M3Y4R4
ENSMPUP00000006315 ENSMPUP00000006315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]