SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y4Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y4Y8
Domain Number 1 Region: 262-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-52
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 22-82
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000336
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y4Y8
Sequence length 445
Comment (tr|M3Y4Y8|M3Y4Y8_MUSPF) Tripartite motif containing 14 {ECO:0000313|Ensembl:ENSMPUP00000006389} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=TRIM14 OC=Mustelinae; Mustela.
Sequence
MAGAGARSETPGGPGPPEREDASGWRCPEHGDRVAELYCRRCRRCVCALCPVLGAHRGHP
VGLALEEAVHVQKLIQECLKQLETKKQQNVGNITHIEDTAEKLKAHAESSKTWLMGKFTE
LRLLLDEEEALAKKFIDKNTQLTLQAYRQHIESCKEQIDGMHSLSTRVWRISQEPDPIQL
LQEYRAAEQEMQRQTSLGEVCYPTPLSFEPVKSFFQGFVDAMQSLLQTPLDTRLKENTNC
QLSGSSSTKLASLLKTSPSPERSLFLKYARTPTLEPDTMHARLRLSADRLTVRCGLMGRL
GPTPALRFDKLWQVLCRDCYAAGRHYWEVDVQEAGVGWWVGVAYASLRRCGASASARLGC
NRQSWCLKRYDLEYWAFHDGQRSRLRPRDDPDRLGVFLDYEAGILSFYDVSGGMSHLHTF
RAAFQEPLYPALRLWEGAISISRLP
Download sequence
Identical sequences M3Y4Y8
ENSMPUP00000006389 XP_004747732.1.14098 ENSMPUP00000006389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]