SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y560 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y560
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000101
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 731-857
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000157
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000114
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000082
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000962
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 708-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  M3Y560
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0383
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y560
Sequence length 1218
Comment (tr|M3Y560|M3Y560_MUSPF) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=JAG1 OC=Mustelinae; Mustela.
Sequence
MRSPRTRGRPGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGVRN
PGDRKCSHDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNERNRI
VLPFSFAWPRSYTLLVEAWDSSNDTLQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSL
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGTCNEPWQCLCETNWGGQLCDKDLNYC
GTRQPCLNGGTCSNTGPDKYQCSCPEGYSGSNCEIAEHACLSDPCHNRGSCRETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWTGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCEREVDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDVDYCEPNPCQNGAHC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGSCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGDSFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITVGSVIPDGARWDDDCNACQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVRPCTGVGECRSSSLQPVKTKCTSDPYYQENCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCVRKRRKPSSHARSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPAKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences M3Y560
XP_004751626.1.14098 ENSMPUP00000006461 ENSMPUP00000006461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]