SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y588 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y588
Domain Number 1 Region: 338-499
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.83e-29
Family Staphylococcal nuclease 0.0062
Further Details:      
 
Domain Number 2 Region: 189-330
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.66e-28
Family Staphylococcal nuclease 0.0073
Further Details:      
 
Domain Number 3 Region: 519-662
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.71e-28
Family Staphylococcal nuclease 0.001
Further Details:      
 
Domain Number 4 Region: 18-168
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.96e-27
Family Staphylococcal nuclease 0.002
Further Details:      
 
Domain Number 5 Region: 705-793
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.02e-21
Family Tudor domain 0.00000629
Further Details:      
 
Domain Number 6 Region: 739-761,788-900
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.44e-16
Family Staphylococcal nuclease 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y588
Sequence length 909
Comment (tr|M3Y588|M3Y588_MUSPF) Staphylococcal nuclease and tudor domain containing 1 {ECO:0000313|Ensembl:ENSMPUP00000006489} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SND1 OC=Mustelinae; Mustela.
Sequence
MASSAQSGGTSGVPAVPTVQRGIVKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
ENPRHFVDSRHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
PEPFAAEAKFFTESRLLQRDVQIVLESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
MDKAGNFIGWLHVDGANLSVLLVEHALSKVHFTAERSAYYKPLLSAEETAKQKKEKVWAH
YEEQPVEEVAPVLEEERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASH
PPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKVHVFYIDYGNREILPSTRLGTLP
PAFSTRVLPAQATEYAFAFIQVPQDEDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHVT
LQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRAD
DADEFGYSR
Download sequence
Identical sequences M3Y588
XP_004741894.1.14098 ENSMPUP00000006489 ENSMPUP00000006489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]