SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y5J4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y5J4
Domain Number 1 Region: 445-574
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 3.01e-46
Family Lamin A/C globular tail domain 0.0000112
Further Details:      
 
Domain Number 2 Region: 310-386
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.01e-18
Family Intermediate filament protein, coiled coil region 0.00012
Further Details:      
 
Domain Number 3 Region: 34-67
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000022
Family Intermediate filament protein, coiled coil region 0.0018
Further Details:      
 
Weak hits

Sequence:  M3Y5J4
Domain Number - Region: 125-218
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00259
Family Myosin rod fragments 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y5J4
Sequence length 614
Comment (tr|M3Y5J4|M3Y5J4_MUSPF) Lamin B2 {ECO:0000313|Ensembl:ENSMPUP00000006595} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=LMNB2 OC=Mustelinae; Mustela.
Sequence
ARGTLPARETTAPGLPRAAATDYKSQPTRLSRLQEKEELRELNDRLAHYIDRVRALELEN
DRLLLKISEREEVTTREVSGIKTLYESELADARRVLDETARERARLQIELGKLKAELEEA
NKGSKRRDGELAAAQGRVKDLESLFHRSEAELAAALSEKRGLESDVAELRAQLAKAEDGH
AVAKKQLEKETLMRVDLENRCQSLQEELDFRKNVFEEEVRETRRRHERRLVEVDSSRQQE
YDFKMAQALDELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAASAAREELQEAR
VRLESLSYQLSGLQKQASAAEDRIRELEETMAGERDKFRKMLDAKEQEMTEMRDVMQQQL
AEYQELLDVKLALDMEISAYRKLLEGEEERLKLTPSPSSRVAVSRATSSSSSSSVSTAGR
SGRSKRKRLEAEESPGAGSSGIGTGTGSSSSTTSFHLAQQASASGGVSIGEIDLEGRFVQ
LKNSSDKDQSLGNWRIKRQILEGEEISYKFTPKYVLRAGQTVTVWAAGAGVAHSPPSTLV
WKSQDSWGTGQSFRTVLVNADGEEVAMRTVKQSSVVRETENGEEGEEEAAEFGEEDLFHQ
QGDPRTTSRGCRVM
Download sequence
Identical sequences M3Y5J4
ENSMPUP00000006595 ENSMPUP00000006595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]