SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y5K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y5K4
Domain Number 1 Region: 375-451
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.6e-21
Family Intermediate filament protein, coiled coil region 0.0004
Further Details:      
 
Domain Number 2 Region: 141-175
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000194
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 187-253
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000837
Family Intermediate filament protein, coiled coil region 0.0044
Further Details:      
 
Weak hits

Sequence:  M3Y5K4
Domain Number - Region: 307-375
Classification Level Classification E-value
Superfamily Prefoldin 0.00068
Family Prefoldin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y5K4
Sequence length 529
Comment (tr|M3Y5K4|M3Y5K4_MUSPF) Keratin 79 {ECO:0000313|Ensembl:ENSMPUP00000006605} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KRT79 OC=Mustelinae; Mustela.
Sequence
MRSSVSRQTYSTKGGFSSNSASGGGGSRGHTSFSSVTVSRSSSSGGGTRCGPSRAGFGSR
SLYNLGGSKSISVSVAGGASSGRALGGFGFGSGAYVGLGAGRQAFGPACPPGGIQEVTVN
QSLLTPLNVEIDPEIQRVRTQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWALLQEQ
GQNSGVTRNNLEPLFENYLGNLRRQLDNLQSDRGRLDSELRNVQDVLEDFKSKYEDEINK
RTAAENEFVLLKKDVDAAYMSRMDLTGKVGTLTEELDFLNHLYEMELSQVQTHVSDTNVI
LSMDNNRRLDLDSIIAEVKAQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDSLRDTKN
EIAELTRTVQRLQGEVDAVKKQCQQLQAAIAEAEQRGDMALKDAQKKLGDLDMALHQAKE
DLARLLRDYQALMNVKLALDVEIATYRKLLESEESRMSGECPSAVSISVTGNSTTVCGGG
AASFGGGMSLGGGGGASKGGFSTVKGGAVSGGTSILRKTTTVKTSSRRY
Download sequence
Identical sequences M3Y5K4
ENSMPUP00000006605 ENSMPUP00000006605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]