SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y5M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y5M3
Domain Number 1 Region: 636-662,697-850
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.87e-37
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 83-278
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.35e-35
Family Laminin G-like module 0.0099
Further Details:      
 
Domain Number 3 Region: 250-431
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-34
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 4 Region: 881-1087
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-27
Family Laminin G-like module 0.02
Further Details:      
 
Domain Number 5 Region: 2-91
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.91e-26
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.001
Further Details:      
 
Domain Number 6 Region: 490-548
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000012
Family Fibrinogen C-terminal domain-like 0.0052
Further Details:      
 
Domain Number 7 Region: 462-498
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000706
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y5M3
Sequence length 1226
Comment (tr|M3Y5M3|M3Y5M3_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000006624} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MEVTAVATQGGYGSSYWVTSYVLMFSDGGRNWKQYRREESVSGFPGNTNADSVVHYRLQP
PLEARFLRFLPLAWSPKGRIGMRMEVYGCTYRSKMVNFDGKSSLLYTLNQKSMSPAKDVI
SLKFKTRQTDGILLHREGQNGKHVTLQLVRGKLILLLNSGCANLPSPDAHVTLTLGSLLD
DEHWHSVLIELGNTHVRFTVDRHSQHFQAEGECDYLDLDYKISFGGIPGHGKSVAFPQKD
FHGCFENLYYNGVDLIDLSKKHTPQILVMGNVSFSCSHPQTVPVTFLSSRSYLALPGTVG
EDKVSVTFQFRTWNRAGLLLTTQFQHGPVALVLVLNDGKLRLSLSQPGHTARDVTAGAGL
SDGQWHSVSLSLKGNDLSVMVDGEAASVAHSLRGQIDSGDTYYLGGCPDRSSGPGCGGPL
AGFQGCLRLISIGDKAVDPITVQQGSLGTFRDLQIDTCGLTDRCLPSYCEHGGECSQSWD
TFSCDCAYTGYTGATCHSSLFEQSCDAHRHRGDSSGFYYIDSDGSGPLGPALVYCNVTED
TTWTSVQHNGSQLAKVKSLNGESPQPLFFKYTASPDQLQAIMDGADDCRQELVLHCKKSR
LSTSRDGTPVSWWIGRTNETHTYWGGSLPGVQKCACGLQGNCLDSQYHCNCAAARNEWTS
DTVVLSHKEHLPVTQVVMRDTGRPHSEAAYVLGPLLCSGDNSFWNSASFNTETSYLHFPT
FRGELSADLSFFFKTTAPSGVFIENLGITDFIRLELHAPTEVTFSFDVGNGRCEVTVRSP
TPFNDNRWHHVRAERNVKEATLQVDQLPSKTQAAPADGHARLQLNSQLFVGGTATRQRGF
LGCIRSLRLNGLALDLEERATMTPGVDPGCRGHCSSYGHLCRNGGRCRERPRGIICDCAF
SAYDGPFCESEISAYFGTGSSIIYDFQEHSNYTSSKNSSSFAALLHEGLTLAGEVATLSF
RTTGTPSLLLYVSSFYEEYLSVILTPNGSLQIRYKLDRHQEPDVFNFGFKNFADGRLHQV
TIHREEVVVSVEVDQSARRQVVLSSGAEFNAVKSLMLGTILEPPGADPDTLRAGVRGFTG
CLSAVRFGPAAPLKAALRPSGPVVVTVRGHVATASRCAESVGPGAPAREATRPLAGGAGG
SGPADGGEPLVSADRSGPAVIGGVIAVVVFVLLCLTAIAARIYQQRWLYQKNGSTVPPAG
DSAETALKSEVNVQSSVSESQREYFF
Download sequence
Identical sequences M3Y5M3
ENSMPUP00000006624 XP_012904758.1.14098 ENSMPUP00000006624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]