SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y5T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y5T4
Domain Number 1 Region: 802-1158
Classification Level Classification E-value
Superfamily RNI-like 2.21e-75
Family 28-residue LRR 0.00000216
Further Details:      
 
Domain Number 2 Region: 28-117
Classification Level Classification E-value
Superfamily DEATH domain 2.47e-23
Family Pyrin domain, PYD 0.0074
Further Details:      
 
Domain Number 3 Region: 253-345,372-440
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000125
Family G proteins 0.067
Further Details:      
 
Domain Number 4 Region: 743-821
Classification Level Classification E-value
Superfamily RNI-like 0.0000322
Family 28-residue LRR 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y5T4
Sequence length 1177
Comment (tr|M3Y5T4|M3Y5T4_MUSPF) NLR family pyrin domain containing 5 {ECO:0000313|Ensembl:ENSMPUP00000006685} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=NLRP5 OC=Mustelinae; Mustela.
Sequence
SILLRNPLFQQNLRSQPCTKMREAKLPSFSNYALQWCFMQLSKEEFQMFKGLLMEKASEV
AVCSFPWVEVNNADMEHLASLLHEHYEESLLWKISNHIFETMGLSTLSEKARQEMKKYSL
AEIQENSTQMKKEEPSMKEVPEISQAIEQGGAISAEIKEQETVEEARSMEVKFFHSLGAR
QQDASKLPFRESAGFLFSLPLSNLGRGDKTRDYKGYVMTKFAAKSDEFHGFEHLASDCPE
IQMLLGAFNPDQTGFQPRTVVLHGKSGIGKSALAQRVLQCWAQGELYQVRFSYIFFLRAR
DMQCMREGSFAELISGEWPDSPVPMMEIMSQPERLLFIVDGFDDLHFALQDDNASLCEDW
AVKRPPSVLMRSLLKKVLLPESSLMITVRDTGIEKLKSMLTSPCYLLVGGISVEKRVQLL
LRHMKNEHQKTQALRAVADSRSLLDACQVPVLGSLICEALNLQEACGEHLSPPCHTLTGL
YTTFVFHQLGPQDASRRRLSQDETAVLRSLCLLAVQGVWHRKFVFYADDLRAHGLRESEL
SALLHTDLLLQDGRQERCCYSFLHISLQEFCAALHYVLEGLETGSHPCLVLMQGLAALRP
AGSDSHLHQMKRFLFGLMSKEGTGALEVLLGCCVPRALKRGLLSWISLLGRQPGTCTPPD
LLDAFHCLFETQDEEFVRLALDSFQEVWLPIGHRTDVLVSAFCLQRCRYLQRIHIEVPQS
LSKDEFSDAQPLIPQGMPAKTLAAECWESLCIVLSTHPSLRELDLSGSVLNEQAMKTLCI
KLRQPTCKIQNLIFKDAQVPLGLRHLWMVLITNHNMKYLNLESTRLKEADLMMACQALRH
PSCLLESLRLDHCGLTPACCLVISQILITSISLKSLSLVGNKLATQGVKALCESLTASQC
ALQKLILGNCGLTAADCRDLASALISNQSLTHLCLSSNSLGREGVNLLCRAIKLPSCGLQ
RLILNECNLDVAGCGFLAFALMGNKRLTHLSLSMNPVEDDGMNLLCEVLMEPSCHLQDLE
MVKCHLTATCCKKLSCVITRNKHLKSLDLAVNALGDDGIMALCEGLRHRRASVWRLGLEA
CGLTSGCCEALATAVLGSQCLTSLNLMRNDLSPEGMTTLCLALAQPTCNLQIIGLWKWQY
PTQTRKLLEEVQRQKPQMIIGDSWYSTDEDDRYWWKN
Download sequence
Identical sequences M3Y5T4
ENSMPUP00000006685 ENSMPUP00000006685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]