SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y604 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y604
Domain Number 1 Region: 368-444
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.03e-21
Family Intermediate filament protein, coiled coil region 0.00061
Further Details:      
 
Domain Number 2 Region: 136-170
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000324
Family Intermediate filament protein, coiled coil region 0.0017
Further Details:      
 
Domain Number 3 Region: 177-246
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000837
Family Intermediate filament protein, coiled coil region 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y604
Sequence length 468
Comment (tr|M3Y604|M3Y604_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000006755} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSRQLHHRPAGERTGFSGCSAVISGRVSTSSASFRAGVKGTAAFGSRSLFSLGGGRRLAL
CAAAGRGGAFALGHCSGSGGGRLGGFVGTVFGSAGLGPVCPSVCPPGGIPQVTVNKSLLA
PLNVELDPEIQKVRAQEREQIKALNNKFASFIDKVRFLEQQNQVLETKWNLLQQLDLNNC
RKNLEPIYEGYISNLRKQLETQTGDRVRLDSELRNMQDLVEDYKKRYEVEINRRTAAENE
FVVLKKDVDAAYMNKVELQAKVDSLTDEIKFFKCLYEGEIAQIQSHISDMSVILSMDNNR
DLNLDSIIDEVRAQYEEIALKSKAEAEALYQTKFQELQLAAGRHGDDLKNTKNEISELTR
LIQRIRSEIENVKKQASNLETAIADAEQRGDNALKDARAKLDELESALHQAKEELARMLR
EYQELMSLKLALDMEIATYRKLLESEECRMSGEFPSPVSICKYLCAGP
Download sequence
Identical sequences M3Y604
ENSMPUP00000006755 ENSMPUP00000006755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]