SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y6D7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y6D7
Domain Number 1 Region: 395-472
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 1.52e-24
Family Intermediate filament protein, coiled coil region 0.00035
Further Details:      
 
Domain Number 2 Region: 163-197
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000157
Family Intermediate filament protein, coiled coil region 0.0015
Further Details:      
 
Domain Number 3 Region: 202-273
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000324
Family Intermediate filament protein, coiled coil region 0.0064
Further Details:      
 
Weak hits

Sequence:  M3Y6D7
Domain Number - Region: 304-396
Classification Level Classification E-value
Superfamily Prefoldin 0.000445
Family Prefoldin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y6D7
Sequence length 566
Comment (tr|M3Y6D7|M3Y6D7_MUSPF) Keratin 75 {ECO:0000313|Ensembl:ENSMPUP00000006888} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KRT75 OC=Mustelinae; Mustela.
Sequence
TMSIKSTMKSQNISHHGFSASSARVPGVCRSGFSSVSVSRSRGSGGLGGACGGAGFGSRS
LYGLGGSKRISIGGGSCAISGGYGGRVGGGFGYGGGASSGFGFGGAAGGGFGLGGGPGFA
GGYGSSGFPVCPPGGIQEVTVNQSLLTPLNLQIDPAIQRVRKEEREQIKTLNNKFASFID
KVRFLEQQNKVLETKWELLQEQGSKTVRQNLEPFFDTYINDLRRQLDSITTERGRLDAEL
RNMQDVVEDFKVRYEDEINKRTAAENEFVALKKDVDSAYMNKVELEAKVNSLTDEINFFR
MLFEAELSQMQTQVSDTSVVLSMDNNRSLDLDSIIAEVKAQYEDIANRSRAEAESWYQTK
YEELQVTAGRHGDDLRNTKQEISEMNRVIQRLRAEIDSVKKQCSSLQTAIADAEQRGELA
LKDARAKLVDLEEALQKAKQDMARLLREYQELMNVKLALDVEIATYRKLLEGEECRLSGE
GVSPVNISVVTSTVSSGYGGGSSLGGGSLGLSGGSGYSFTTSVGHNLGSGLGGSSFSASS
SRGLGSSGSSVKFVSTTSSSRKSYKH
Download sequence
Identical sequences M3Y6D7
ENSMPUP00000006888 ENSMPUP00000006888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]