SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y6G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y6G5
Domain Number 1 Region: 176-450
Classification Level Classification E-value
Superfamily Caspase-like 8.97e-83
Family Caspase catalytic domain 0.000000000317
Further Details:      
 
Domain Number 2 Region: 32-123
Classification Level Classification E-value
Superfamily DEATH domain 3.96e-21
Family Caspase recruitment domain, CARD 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y6G5
Sequence length 452
Comment (tr|M3Y6G5|M3Y6G5_MUSPF) Caspase 2 {ECO:0000313|Ensembl:ENSMPUP00000006916} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=CASP2 OC=Mustelinae; Mustela.
Sequence
MAAPSTGSRPALQRKALMAADRGRRILGVCGMHPDHQEALKKNRVVLAKQLLLSELLEHL
LERDIITLEMREHIQGKVGSFSQNVELLNLLPKRGPHAFDAFCVALRETKQGHLEDLLLT
TLSGLQHARPPLSCDYDLSLPFPMCESCPPHKQLRLSPDTVEHSLDHGDGPPCLQVKPCT
PEFYQTHYQLAYRLQSQPRGLALVLSNVHFTGEKDLEFRSGGDVDHSTLVTLFKLLGYKV
HVLLDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGGIYGVDGKLLQLQEVFRLF
DNASCPNLQNKPKMFFIQACRGDETDRGVDQRDGKNHTGSSECEESDASKEEMLKARLPT
RSDMICGYACLRGTAAMRNTKRGSWYIEALTQVFSERACDMHVADMLVKVNALIKEREGY
APGTEFHRCKEMSEYCSTLCRPLYLFPGHPPT
Download sequence
Identical sequences M3Y6G5
ENSMPUP00000006916 XP_004772113.1.14098 ENSMPUP00000006916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]