SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y6P5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y6P5
Domain Number 1 Region: 410-771
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 3.01e-118
Family Oxysterol-binding protein 0.0000114
Further Details:      
 
Domain Number 2 Region: 13-123
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-24
Family Pleckstrin-homology domain (PH domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y6P5
Sequence length 777
Comment (tr|M3Y6P5|M3Y6P5_MUSPF) Oxysterol-binding protein {ECO:0000256|RuleBase:RU003845} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=OSBPL9 OC=Mustelinae; Mustela.
Sequence
MPYRRVTSGRLLSLAAPKMASIMEGPLSKWTNVMKGWQYRWFVLDYNAGLLSYYTSKDKM
MRGSRRGCVRLRGAVIGIDDEDDSTFTITVDQKTFHFQARDADEREKWIHALEETILRHT
LQLQISTTLAFFQSSGISPVLEFSKIIGLDSGFVPSVQDFDKKLTEADAYLQILIEQLKL
FDDKLQNCKDDEQRKKIETLKETTNSMVESIKHCIVLLQIAKDQCNAEKHADGIISTINP
VDAIYQPSPLEPVINTMPTQTVLPPEPSQLCKSEQRPSSLPVGPVLTTLGHHQTPTPNST
GSGHSPPSSSLTSPSHVNLSPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSAS
VLTHSSSGNSLKRPDTTESLNSSMSNGTSDADLFDSHDDRDDEGEAGSVEEHKSVIMHLL
SQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDARDRMVQVVKWYLS
AFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTELVSEGPVPWVSKNCVTFVAEQV
SHHPPISAFYAECFNKKIQFNAHIWTKSKFLGMSIGVHNIGQGCVSCLDYDEHYILTFPN
GYGRSILTVPWVELGGECNINCSKTGYSANIVFHTKPFYGGKKHRITAEIFSPNDKKSFC
SVEGEWNGVMYAKYATGENAVFIDTKKLPIIKKKVRKLEDQNEYESRCLWKDVTFNLKIR
DIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLLKRLGAAKH
Download sequence
Identical sequences M3Y6P5
ENSMPUP00000006996 ENSMPUP00000006996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]