SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y6V8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y6V8
Domain Number 1 Region: 438-509
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000034
Family LIM domain 0.0073
Further Details:      
 
Domain Number 2 Region: 376-443
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000122
Family LIM domain 0.0092
Further Details:      
 
Domain Number 3 Region: 348-374
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000513
Family LIM domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y6V8
Sequence length 548
Comment (tr|M3Y6V8|M3Y6V8_MUSPF) Ajuba LIM protein {ECO:0000313|Ensembl:ENSMPUP00000007059} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=AJUBA OC=Mustelinae; Mustela.
Sequence
MERLGEKASRLLEKLRLSDSGSAKFGRRKGESSRSGSDGTPGPGKGRLSGLGGPRKSGPR
GATGGPGDEPLEPAREQGPLDAERNPRGSFEAQRYEGSFPGGPPPTRALPLPQSLPPDFR
LETTAPALSPRSSFASSSASDASKPSSPRGSLLLDGAGAGGAGGSRPCSNRTSGISMGYD
QRHGSPLPAGPCLFGPPLAGAPAGYSPGGVPSAYPELHAALDRLCAHRPAGFGCQESRHS
YPPALGSPGALAGAGVGATGPLERRGAQPGRHSVTGYGDCAAGARYQDELTALLRLTVGT
GGREAGARGEPSGIEPSGLEEPPGPFLPEAARARMREPEAREDYFGTCIKCNKGIYGQSN
ACKALDSLYHTQCFVCCSCGRTLRCKAFYSVNGSVYCEEDYLFSGFQEAAEKCCVCGHLI
LEKILQAVGKSYHPGCFRCIVCNKCLDGIPFTVDFSNQVYCVTDYHKNYAPKCAACGQPI
LPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLST
RQPPASYI
Download sequence
Identical sequences M3Y6V8
XP_004755404.1.14098 ENSMPUP00000007059 ENSMPUP00000007059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]