SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y6Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y6Y3
Domain Number 1 Region: 661-726
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-21
Family SH3-domain 0.00079
Further Details:      
 
Domain Number 2 Region: 491-554
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-20
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 3 Region: 558-642
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.00089
Further Details:      
 
Domain Number 4 Region: 746-788
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000171
Family SH3-domain 0.0016
Further Details:      
 
Domain Number 5 Region: 399-486
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000021
Family SH3-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y6Y3
Sequence length 790
Comment (tr|M3Y6Y3|M3Y6Y3_MUSPF) SH3 domain containing 19 {ECO:0000313|Ensembl:ENSMPUP00000007086} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SH3D19 OC=Mustelinae; Mustela.
Sequence
MNIMNTERSQNSVVSRIKAFEGQTNKETSGPPVKPEITPRTLPPRPALPSGKPLVAPKPA
ANRASGEWDSWTENRLKVAPREGLTPQSPPQEVGSIPVTKPELPKKPNAGLTRSINHEIL
GGGPMAESPDGGKKVPTPAPRPLLPKKSVSLEIPNSTALLKPVTVPPRLSVASQAKAFRS
LGEGPPAVSLAASQQSKPPGDIDLISFDDDVLPTPAGNLVEESLGSEMVLVDPFQLPIKT
EPTKERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPIEKPIGNTCSTVSGKLSTVD
RIRNLESDHTGQTGGSVRGPPRLPPRPVNGKAIPARQPPHRGAPERPPPPKLSASRASSK
KLPFNRSSSDMDLQKKQSNLASGLSKAKSQVFRTQDPVLPPRPKPGHPLYRKYMLSVPHG
IANEDIVSQNPGELSCKRGDVLVMLKQAENNYLECQKGEDTGRVHLSQIKIITPLDEHLR
SRPNDPNHAQKPVDSSAPHAVVLHDFPAEQADDLHLTSGEIVYLLEKIDPDWYRGRCRNQ
TGIFPANYVRVMVDVPEGGNGKRESVSSHCVKGPRCVARFEYIGDQKDELSFSEGEIIIL
KEYVSEEWARGELRDRIGIFPLNFVELVEDHPISGTNVFSTKVPPKTKKEDSGANSQDTS
LSGEWCEALHSFTAETSDDLSFRRGDRILILERVDADWYKGRLRDREGIFPAVFVRPCPG
TATAEMTVSLQGEPETFRSGFLVSSQQRLSFKAGDIITELESVDDDWMSGELMGKSGIFP
KNYVQFLQVS
Download sequence
Identical sequences M3Y6Y3
ENSMPUP00000007086 ENSMPUP00000007086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]