SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y729 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y729
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.03e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 103-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.12e-38
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 313-505
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-34
Family Laminin G-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 531-589
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000335
Family Fibrinogen C-terminal domain-like 0.003
Further Details:      
 
Domain Number 5 Region: 502-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000089
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y729
Sequence length 655
Comment (tr|M3Y729|M3Y729_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000007133} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MSGSYSPGYAKINKRGGAGGWSPSDSDHYQWLQVDFGNRKQISAVATQGRYSSSDWVTQY
RMLYSDTGRNWKPYHQDGNIWAFPGNINSDSVVRHDLQHPVIARYVRIVPLDWNGEGRIG
LRIEVYGCSYWADVINFDGHVVLPYRFRNKKMKTLKDVIALKFKTSESEGVILHGEGQQG
DYITLELKKAKLVFSLNLGSNQLGPIYGHTSVTTGSLLDDHHWHSMVIERQGRSINLTLD
RGVQHFRTNGEFDYLDLDYEITFGGIPFSGKPSSSSRKNFKGCMESINYNGINITDLARR
KKLEPSNVGNLSFSCVEPYTVPVFFNATSYLEVPGRPNQDLFSVSFQFRTWNPNGLLLFS
QFADNLGNVEIDLTESKVGVHINVTQTKMSQIDISSGSGLNDGQWHEVRLLAKENFAILT
IDGDEASAVRTNSPLQVKTGEKYFFGGFLNQMNNSSHSVLQPSFQGCMQLIQVDDQLVNL
YEVAQRRPGSFANVSIDMCAIIDRCVPNHCEHGGKCSQTWHSFQCACEETGYSGATCHNS
IYEPSCEAYKHLGQTSNYYWIDPDGSGPLGPLKVYCNMTEDKVWTIVSHDLQMQTTVVGY
SPEKYSVTQLVYSASMDQISAVTSSAEHCEQYVSYFCKMSRLLNTPGRLRMECYF
Download sequence
Identical sequences M3Y729
ENSMPUP00000007133 ENSMPUP00000007133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]