SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y795 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y795
Domain Number 1 Region: 777-849
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000204
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y795
Sequence length 858
Comment (tr|M3Y795|M3Y795_MUSPF) FYN binding protein 2 {ECO:0000313|Ensembl:ENSMPUP00000007202} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FYB2 OC=Mustelinae; Mustela.
Sequence
MECGRCPASAGKAPVPREGGAAPQVGQVGHLSSGVSRALGGDCSLASANKPKRTLGPRIQ
LWETAFVSQTLPRRKAMEGAIASPADSTYREGLRNFKELRAKFQKFDMPLPPGPIKFSAG
VSQKGNIGNTQSTRILANGKSLSSSHSLLPLCSSAESQLLKDQETKLAQRSEIQKCSNSP
GPLERSSGPAVNSQKSSPLLDRNPSNAEITNKRRVTMNESFKDKLWNWEKFSSQKSESSS
ASLLARCACRICHAEEQKSRGLLPKEPRIMLEIKGTQTLPSQRHLVAQRESLTFPEDPTF
LLFQHGKKNLENPLPEKSPVRGSCQLVYESELSSQAPDSEKQSVDKHQQLLKTKPLPSIE
SLGPPPPKPPKPPVVNLQAFQKQAATISKTHTEAAVEEGCLPPESAEFEEPHNYEATISY
LKHSGNSINLCTAKEIADSTYEVEIEEPQKPRKNGLHQELSPKYEDEDEDKKEKEKEPCE
LEPQKPQKDLPSSHLFKYSLIRSALEVFLHPVSQPRERTSPPPFLSQRTTQLQTALATWY
LKGATRGGMLGRKQVMKVLGGRRSMLPRKQGPVSDATQTKACLQDPKLARHSLGHCGYVE
TLEDTTEMPDGGACKPHSNSEETYDDVEYPGRAGPQSDLSNSFASDNEENNEEMYEEVYK
TKSNYPKIDLDGKEALKRLRKFFKKEKDRFKMKKNKLKENVSAFSISLPDLELRSQEAII
YDNVDISEKESRDENKLKTWKPKFLMAKEKKERKGAEESERNFFRTKKQNLEKMRMEKEE
KRFREQFEYDKEITVINTAVACSSNSRNGIFDLPITPGEELQVIDTTEENLVICRNSKGK
YGYVLIEHLDFKHQGWSP
Download sequence
Identical sequences M3Y795
ENSMPUP00000007202 ENSMPUP00000007202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]