SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y7F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y7F0
Domain Number 1 Region: 872-1082
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-55
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 1245-1431
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-26
Family Pleckstrin-homology domain (PH domain) 0.00000889
Further Details:      
 
Domain Number 3 Region: 1071-1191
Classification Level Classification E-value
Superfamily PH domain-like 6.8e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y7F0
Sequence length 1435
Comment (tr|M3Y7F0|M3Y7F0_MUSPF) FYVE, RhoGEF and PH domain containing 6 {ECO:0000313|Ensembl:ENSMPUP00000007257} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=FGD6 OC=Mustelinae; Mustela.
Sequence
MKYNLPSKMQAHHVIKKKIKKPPVAPKPKFVVANNKPAPPPVAPKPDIVISSVPPSTKKT
KPAIAPKPKVLKGSPVRDIGQSASRKIIVNLEEHKQELPENADNSDCRNVGHQSSNYILP
MCSCSSQCVHKLGNRENLCVKQLVLETLETHENLEYSKIEESSSAVKTRSRCDSNVENVK
SQSEVVLKANILEEKLKDVLTQRTSPFISLPKHRSTDSPEINDGYNSNRQFRIEFADLSP
SLSSFEKVPDHHHCHLQLPSDETYQPSSDKSNTCFHSSGQEALENGKSSTFLSSDGVSKK
SEVKDLGPLEIHLVPHTPKFPTPKPRKTRAARLLRQKYVDVPSESTEEPENLDSDSSCLL
EAGLKNDKISVLHHNVLCNQEQVDKVKPGNKSELNVDCSGDRQNLVSPQKAVCPETSSFE
KMETDSNLSSDSKTIDGSSMSLAVDKGTNFIRYSTLSMSLPKQLKLTCNEHLPTTCNVGV
SAPQIQKESTIKGENSSRIVPKKPQRHSLPAAGVLKKAASEEIVEKSSYPSNEENNSEKG
LERNHLQHVCAQNLSMSSSFDMPKRASEKPVWKLPHPILPFSGNPESLKSVTTSSNSELS
TAITKPRAKSLSAMDAERCTKPCKDTQKKNSLKKLLNMKLSICFMKSDFQKFWSKNSQLG
NATAGSLSGGERKGIESDWHGMLVEEKRSKPIKAYSADNYSLESQKKRKKSRGQTSAANG
PRAESLDDQILSRESLSQAPCKSVTSGCAPEYENVRHYEEIPEYENLPFIMAIGKTPELE
WQNSRSMEDTDANVYEVEEPYEAPGGQLQLGPRHQHSSSGASQEGHNDLDLGLGELPSDE
EEDINSSDEDDVSSDSSKGDPDLGDKQNEDTGMKSKVHHIAKEIMSSEKVFVDVLKLLHI
DFRDAVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMSNWTEQHRIADI
FVKKGPYLKMYSTYIKEFDKNIALLDEQCKKNPAFAAVVRDFEMSPRCANLALKHYLLKP
VQRIPQYKLLLTDYLKNLLEDSGDYRDTQDALAIVIEVANHANDTMKQGDNFQKLMQIQY
SLNGHHEIVQPGRVFLKEGTLMKLSRKVMQPRVFFLFNDALLYTTPMQSGMYKLNNMLSL
AGMKVRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRITFCPS
RSLDEADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQAC
SSNKYGLDYLKNQPARVCEHCFQELQKLDHQHSPKIGSPGNHKSPSSALSSVLHSIPSGR
KQKKIPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALE
SQPLLGFTVTQVKDENSESRVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences M3Y7F0
ENSMPUP00000007257 ENSMPUP00000007257 XP_012909647.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]