SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y7K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y7K0
Domain Number 1 Region: 121-253
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-38
Family Third domain of FERM 0.00052
Further Details:      
 
Domain Number 2 Region: 19-123
Classification Level Classification E-value
Superfamily Second domain of FERM 3.27e-33
Family Second domain of FERM 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y7K0
Sequence length 747
Comment (tr|M3Y7K0|M3Y7K0_MUSPF) Erythrocyte membrane protein band 4.1 like 4B {ECO:0000313|Ensembl:ENSMPUP00000007307} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=EPB41L4B OC=Mustelinae; Mustela.
Sequence
MKIGPSYALHFRVKYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCL
QAELGECELPEHTPELVSEFRFIPNQTEAMEFDIFQRWKECRGKSPAQAELSYLNKAKWL
EMYGVDMHVVRGRDGCEYSLGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLVVVE
DDDQGREQEHTFVFRLDSARTCKHLWKCAVEHHSFFRLRTPGNSKSNRSDFIRLGSRFRF
SGRTEYQATHGSRLRRTSTFERKPSKRYPSRRHSTFKATNPVIAAQFCSKTNPEVHNYQP
QYHPTIHPSQPRWHPHSPNVSYPLPSPGLSSSDRLPFGVEENGGPSRASARHHHHHHQHQ
HQHHPNYGLSLTLENKEGPSRSPNSSSKSLTKLSPGPPALFSEAAAHLKKLELETVKAPG
PWPALHININKAEEKKVSEKTLQTPLLPSPVADHVKCNILKAQLENASRVSAQVGKEEST
FVNINKKSSLQDANVRSPIPIRVETTQPVLEKPEIKPPRVRKLTRQYSFDEDDLPPDLAE
AVGAPTATATNTTAATTQVSVPLVSPKGHKLSSPQNSESKGQLSPGAKSPSDRGGAFTLE
PGDLLMDFTEATPLAEPASAPHCAHSRCSPPLSPPMKEETTGVCMHPPIKTRLIKTFPAD
PVTPFPDVFNSGPQFTADFRDSKLPCCPGQSSPLIPAVTLRPLTETISTVQTIYTTRKPV
SLAASAETLRQELEREKMMKRLLMTEL
Download sequence
Identical sequences M3Y7K0
ENSMPUP00000007307 ENSMPUP00000007307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]