SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y7S8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y7S8
Domain Number 1 Region: 152-350
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.4e-70
Family Arfaptin, Rac-binding fragment 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M3Y7S8
Sequence length 373
Comment (tr|M3Y7S8|M3Y7S8_MUSPF) ADP ribosylation factor interacting protein 1 {ECO:0000313|Ensembl:ENSMPUP00000007385} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARFIP1 OC=Mustelinae; Mustela.
Sequence
MAQESPKNSAAEIPVTSNGEVDDSHEHGFNRDLKRSLPAGLGLSETQITSHGFDSTKEGV
IEAGSFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILRLAQ
TLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIA
SVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH
KEKYDKMRNDVSIKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLK
TPGVDAPSWLEEQ
Download sequence
Identical sequences M3Y7S8
ENSMPUP00000007385 XP_004758130.2.14098 XP_004758132.2.14098 ENSMPUP00000007385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]