SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y7U3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y7U3
Domain Number 1 Region: 125-196
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000798
Family LIM domain 0.011
Further Details:      
 
Domain Number 2 Region: 93-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000246
Family LIM domain 0.0087
Further Details:      
 
Domain Number 3 Region: 11-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000132
Family LIM domain 0.019
Further Details:      
 
Weak hits

Sequence:  M3Y7U3
Domain Number - Region: 193-226
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0328
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y7U3
Sequence length 240
Comment (tr|M3Y7U3|M3Y7U3_MUSPF) Uncharacterized protein {ECO:0000313|Ensembl:ENSMPUP00000007400} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN= OC=Mustelinae; Mustela.
Sequence
MGSLYHTDCFTCDSCGRRLRGKAFYNVGENVYCQEDFLVSRSWVLATVGESRGGDPPAPC
GDLGPGGRCWLGSEGPFVTGHSGSSVPSQYSGFQQTAEKCSVCGHLIMEMILQALGKSYH
PGCFRCSVCNECLDGVPFTVDVENNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVV
SMDRDYHVECYHCEDCGLQLSGEDGRRCYPLEGHLLCRRCHLRRLRPGPLPSPAVHVTEL
Download sequence
Identical sequences M3Y7U3
ENSMPUP00000007400 ENSMPUP00000007400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]