SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y7V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y7V5
Domain Number 1 Region: 286-506
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.22e-56
Family DBL homology domain (DH-domain) 0.0000674
Further Details:      
 
Domain Number 2 Region: 496-637
Classification Level Classification E-value
Superfamily PH domain-like 3.08e-16
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 3 Region: 650-709
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000103
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M3Y7V5
Sequence length 730
Comment (tr|M3Y7V5|M3Y7V5_MUSPF) Rho guanine nucleotide exchange factor 16 {ECO:0000313|Ensembl:ENSMPUP00000007412} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=ARHGEF16 OC=Mustelinae; Mustela.
Sequence
MDICMPPSPLCFCPRTRRPQSMSQRHSDSSLEEKLLEYRFHSELRLDARGNPAPGLPMVR
DSLQVRDNAAFQLDTSVPPPLSTKDEEPRTVVLSTQSPAALKMGTQQLIPRSLAVCSKAK
TPARHQSFGAAVLSKEAARREPRLVSAPSFSLDDMDVDTGPEGALRRNLRNQSYRAAMQG
LGAPGRERTPIQLSPKLQALAEESSPPPARCPAKNKRTLGRKRAHKGSFKDDPGFYQEIR
ERGLNTSHESDDDLLGEPSSPDGTGKAGAPIVVKSYRPAQVTWSQLPEVVESGLLDELSA
EERKRQEAIFEILTSEFSYQHSLGVLVAEFLQSRELRATMTQTEHHHLFSNILDVLSASQ
RFFEALEQRHKAQVCVEDISDILEEHAEKHFHPYVAYCSNEVYQQRALQKLTNSNAAFHE
ALKEIEKRPACGGLPMISFLILPMQRVTRLPLLTDTLCLKSQGHPERYKAASRALKAISK
LVQQCNEGARRMERTEQMYELHARLDFGRVKSLPLISASRWLLKRGELFVVEETRLFRKL
ASRPTCYLFLFNDVLVVTKKKSEDSFMVQDYAQVDHIRVQKMEPSDPGLLGGGGTRSSSV
PHPFQVTLLHNSEGLQEKILLSSDSASDRARWITALTHGERQGQGPTNKGDLPQVEITKA
YLARQADEITLQQADVVLVLEQEDGWVYGERLRDGETGWFPEDFARSITSRVAVEGNVRR
MERLRVETDV
Download sequence
Identical sequences M3Y7V5
XP_012920164.1.14098 ENSMPUP00000007412 ENSMPUP00000007412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]