SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M3Y821 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M3Y821
Domain Number 1 Region: 24-104
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000341
Family DEATH effector domain, DED 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M3Y821
Sequence length 327
Comment (tr|M3Y821|M3Y821_MUSPF) Death effector domain containing 2 {ECO:0000313|Ensembl:ENSMPUP00000007478} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=DEDD2 OC=Mustelinae; Mustela.
Sequence
MALSGLTPAPSWEEDECLDYYGMLSLHRMFEVVGGQLTECELELLAFLLDEAPGAAGGLA
RARSGLELLLELERRGQCDESNLRLLGQLLRVLARHDLLPHLARKRRRPVSPERYNYGTS
SSSSKRTEGSRRRHRQSSGTSDAQQGQWETGSPPTKRQRRSRGRPSGGARRRRRGTAAAP
QQPQETSRPASEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQLDVFGQATAVL
RSRDLGSVVCDIKFSELSYLDAFWGDYLSGALLQALRGVFLTEALREAVGREAVRLLVSV
DEADYEAGRRRLLLMEEEGGRRPTEAS
Download sequence
Identical sequences M3Y821
ENSMPUP00000007478 ENSMPUP00000007478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]